Clone AT18936 Report

Search the DGRC for AT18936

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:189
Well:36
Vector:pOTB7
Associated Gene/TranscriptCG30487-RA
Protein status:AT18936.pep: gold
Sequenced Size:708

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30487 2003-01-01 Sim4 clustering to Release 3
CG30487 2004-01-09 Blastp of sequenced clone
CG30487 2008-04-29 Release 5.5 accounting
CG30487 2008-08-15 Release 5.9 accounting
CG30487 2008-12-18 5.12 accounting

Clone Sequence Records

AT18936.complete Sequence

708 bp (708 high quality bases) assembled on 2004-01-09

GenBank Submission: BT011409

> AT18936.complete
CGCCAACAATTCTTTACAATTAAAAAGCATGTCTATAGAAAAAATCTCCT
CCGAGCTGCGTAAGATGATAATATCTGACAATCCAATCGAAGCAACAACT
TTCGATAAATCTGCAATAGAGGCAACTTTGGATTCCAACAAATTCGAAGA
TCTACGAATTCCGAAGCATACACTGAAGCAAAAGTTTCTTCTTCGAAAGT
CAATAATTGAACATCCCTTTAAAAGAATTCGTGCCGAAGGAGTGGATTGG
GCTCACAAAATTCGAGACACCGACGAAGAGAAGGAATCTAATTGGGCAAA
GATTGCGACTGGAAAGGTTTCTGGCAATGCCTACGATCTTAAAACCATGA
TGAGCGAGTGTGAAAATATTTGTGGTTACGGAAACGCCATAAACTTGACG
GTCCCAAGGGTGGACAAACTACAGGATCTGGCTAAATCGATCCCAACGGA
TCCCGATACAGTCTACCTGACCTGTCAATGTGATGATATTTTCTCTAATG
GAGGCACAGAAGCTCCGACTCAAAGCCCCGACGAAGTTAATTTCGAAGAG
CTGTCCAGCTACTTCGAAAATATGCTCAACATACCCAAGAATCTTCCGCT
CAGCGCTGAAATAATGTATACTTAATGATTGGAACGGTGTGTGTATTGTT
ATATTTAGAGTAAAAAAAGATATAAATCATTTTAAAAAAAAAAAAAAAAA
AAAAAAAA

AT18936.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG30487-RA 728 CG30487-RA 46..728 1..683 3415 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8824941..8825623 683..1 3415 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:53:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12937615..12938298 684..1 3420 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12938814..12939497 684..1 3420 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:06:47 has no hits.

AT18936.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:08:02 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8824941..8825623 1..683 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:13:08 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
CG30487-RA 1..597 29..625 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:43:54 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
CG30487-RA 1..597 29..625 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:07:26 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
CG30487-RA 1..597 29..625 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:32:56 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
CG30487-RA 1..597 29..625 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:36:46 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
CG30487-RA 1..597 29..625 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:54:19 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
CG30487-RA 46..678 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:43:54 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
CG30487-RA 46..728 1..683 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:07:26 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
CG30487-RA 46..728 1..683 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:32:56 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
CG30487-RA 46..678 1..633 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:36:46 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
CG30487-RA 46..728 1..683 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:08:02 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12937616..12938298 1..683 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:08:02 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12937616..12938298 1..683 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:08:02 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12937616..12938298 1..683 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:07:26 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8825121..8825803 1..683 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:05:21 Download gff for AT18936.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12938815..12939497 1..683 100   Minus

AT18936.hyp Sequence

Translation from 1 to 624

> AT18936.hyp
ANNSLQLKSMSIEKISSELRKMIISDNPIEATTFDKSAIEATLDSNKFED
LRIPKHTLKQKFLLRKSIIEHPFKRIRAEGVDWAHKIRDTDEEKESNWAK
IATGKVSGNAYDLKTMMSECENICGYGNAINLTVPRVDKLQDLAKSIPTD
PDTVYLTCQCDDIFSNGGTEAPTQSPDEVNFEELSSYFENMLNIPKNLPL
SAEIMYT*

AT18936.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG30487-PA 198 CG30487-PA 1..198 10..207 1031 100 Plus

AT18936.pep Sequence

Translation from 28 to 624

> AT18936.pep
MSIEKISSELRKMIISDNPIEATTFDKSAIEATLDSNKFEDLRIPKHTLK
QKFLLRKSIIEHPFKRIRAEGVDWAHKIRDTDEEKESNWAKIATGKVSGN
AYDLKTMMSECENICGYGNAINLTVPRVDKLQDLAKSIPTDPDTVYLTCQ
CDDIFSNGGTEAPTQSPDEVNFEELSSYFENMLNIPKNLPLSAEIMYT*

AT18936.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22538-PA 184 GG22538-PA 1..184 1..198 479 53.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG30487-PA 198 CG30487-PA 1..198 1..198 1031 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20323-PA 172 GM20323-PA 1..172 1..198 697 70.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25801-PA 176 GD25801-PA 1..176 1..198 739 72.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13409-PA 201 GE13409-PA 1..201 1..198 545 57.6 Plus