Clone AT18988 Report

Search the DGRC for AT18988

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:189
Well:88
Vector:pOTB7
Associated Gene/TranscriptCG17329-RA
Protein status:AT18988.pep: gold
Preliminary Size:549
Sequenced Size:690

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17329 2002-01-01 Sim4 clustering to Release 2
CG17329 2002-01-18 Blastp of sequenced clone
CG17329 2003-01-01 Sim4 clustering to Release 3
CG17329 2008-04-29 Release 5.5 accounting
CG17329 2008-08-15 Release 5.9 accounting
CG17329 2008-12-18 5.12 accounting

Clone Sequence Records

AT18988.complete Sequence

690 bp (690 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089367

> AT18988.complete
GTCGACGGAAACAGAGACAGAGACGCAGGAAAAACAGATCAATCTCTTGT
TGGTGGAAATGGAGAAAATCGAGAAGGAACTTGAGCGCACGGAGCAGCAG
CAGCAGGAGCCGACGGAGCCGTCCAATGGCAATCTGGAGGAGCAAGTCCG
CAAGCTCAGGGATCACAATTTGCGGGTGAAGCATCTGAATACTCAGCGTC
GTCGCATCCTACGCCTGTTGCAGGGAAAGATGCTGCAGTATGCCACCCTG
GAGGAACGTTTGCACAGGATTGGCGAACTCGTTCTCATCGCAGAGCTCCA
TTCGGGTGTGAAGACACTCAATCAGCGTCTGGACAGAATGGTGGAGAATT
CAACTTGCTCCATTTGCCTGTTGCCCTGGACGGACAACGGAATACATCGC
CTGGTCTCGCTCCGTTGTGGCCATTTGTTTGGCTCCAGCTGCATCCACAT
GGCCATTCGGCGCAATCATCGCTGCCCAATCTGCCGGCGACGGGCTCGCC
ACTTCCACGTGCGCAGGATCTACAGTCCGAGCTTTTTGTCTCATTAATTC
GACCATCTCAGTTTTTGCGTTTTCATTGAAGTTTTCATATATGTATGTAC
AAACCGTTCTTTTATGGTTGATGTTTGTTCAAAATTCAAGTAAACATTAA
ACACCTTAACTGAGGAAAAAAAAAAAAAAAAAAAAAAAAA

AT18988.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG17329-RA 665 CG17329-RA 1..665 1..665 3325 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16290134..16290798 1..665 3325 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:53:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16291284..16291953 1..670 3350 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16291284..16291953 1..670 3350 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:50:47 has no hits.

AT18988.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:51:51 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16290134..16290798 1..665 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:13:16 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
CG17329-RA 1..489 59..547 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:47:26 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
CG17329-RA 1..489 59..547 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:42:53 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
CG17329-RA 1..489 59..547 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:15:17 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
CG17329-RA 1..489 59..547 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:51:35 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
CG17329-RA 1..489 59..547 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:11:35 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
CG17329-RA 1..665 1..665 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:47:26 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
CG17329-RA 1..665 1..665 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:53 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
CG17329-RA 1..665 1..665 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:15:17 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
CG17329-RA 1..665 1..665 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:51:35 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
CG17329-RA 1..665 1..665 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:51:51 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16291284..16291948 1..665 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:51:51 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16291284..16291948 1..665 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:51:51 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16291284..16291948 1..665 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:53 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16291284..16291948 1..665 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:49:04 Download gff for AT18988.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16291284..16291948 1..665 100   Plus

AT18988.hyp Sequence

Translation from 1 to 546

> AT18988.hyp
STETETETQEKQINLLLVEMEKIEKELERTEQQQQEPTEPSNGNLEEQVR
KLRDHNLRVKHLNTQRRRILRLLQGKMLQYATLEERLHRIGELVLIAELH
SGVKTLNQRLDRMVENSTCSICLLPWTDNGIHRLVSLRCGHLFGSSCIHM
AIRRNHRCPICRRRARHFHVRRIYSPSFLSH*

AT18988.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG17329-PA 162 CG17329-PA 1..162 20..181 855 100 Plus
CG13481-PC 176 CG13481-PC 3..171 1..175 334 42.3 Plus
CG13481-PB 176 CG13481-PB 3..171 1..175 334 42.3 Plus
CG14983-PA 163 CG14983-PA 2..160 15..178 258 39.5 Plus
CG31807-PB 142 CG31807-PB 13..137 46..173 183 35.2 Plus

AT18988.pep Sequence

Translation from 58 to 546

> AT18988.pep
MEKIEKELERTEQQQQEPTEPSNGNLEEQVRKLRDHNLRVKHLNTQRRRI
LRLLQGKMLQYATLEERLHRIGELVLIAELHSGVKTLNQRLDRMVENSTC
SICLLPWTDNGIHRLVSLRCGHLFGSSCIHMAIRRNHRCPICRRRARHFH
VRRIYSPSFLSH*

AT18988.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11644-PA 261 GF11644-PA 113..196 77..160 241 48.8 Plus
Dana\GF21156-PA 369 GF21156-PA 291..367 84..160 211 49.4 Plus
Dana\GF21387-PA 378 GF21387-PA 155..231 79..155 198 44.2 Plus
Dana\GF20023-PA 161 GF20023-PA 84..154 87..156 182 49.3 Plus
Dana\GF10504-PA 763 GF10504-PA 274..348 91..154 156 45.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25198-PA 177 GG25198-PA 19..177 1..162 672 79 Plus
Dere\GG13729-PA 176 GG13729-PA 38..171 22..156 323 50.4 Plus
Dere\GG14234-PA 163 GG14234-PA 30..160 18..159 235 38.7 Plus
Dere\GG21800-PA 134 GG21800-PA 22..129 40..159 225 40 Plus
Dere\GG24361-PA 210 GG24361-PA 116..185 85..155 187 45.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15222-PA 692 GH15222-PA 210..276 96..156 151 44.8 Plus
Dgri\GH13524-PA 158 GH13524-PA 84..154 84..154 139 38 Plus
Dgri\GH13397-PA 171 GH13397-PA 94..170 84..157 138 36.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG17329-PA 162 CG17329-PA 1..162 1..162 855 100 Plus
CG13481-PC 176 CG13481-PC 38..171 22..156 333 49.6 Plus
CG13481-PB 176 CG13481-PB 38..171 22..156 333 49.6 Plus
CG14983-PA 163 CG14983-PA 12..160 6..159 257 40.8 Plus
CG31807-PB 142 CG31807-PB 13..137 27..154 183 35.2 Plus
CG31807-PA 155 CG31807-PA 26..150 27..154 183 35.2 Plus
CG13025-PB 608 CG13025-PB 127..193 96..156 163 46.3 Plus
CG13025-PA 608 CG13025-PA 127..193 96..156 163 46.3 Plus
CG33552-PA 157 CG33552-PA 3..132 15..143 143 29.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13216-PA 214 GI13216-PA 152..210 97..155 174 52.5 Plus
Dmoj\GI12097-PA 263 GI12097-PA 198..255 98..155 166 44.8 Plus
Dmoj\GI15028-PA 241 GI15028-PA 167..237 85..155 156 35.2 Plus
Dmoj\GI11932-PA 684 GI11932-PA 202..265 99..156 151 46.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15113-PA 259 GL15113-PA 187..257 92..162 195 46.5 Plus
Dper\GL15993-PA 270 GL15993-PA 89..267 6..160 190 32.2 Plus
Dper\GL15116-PA 178 GL15116-PA 19..171 25..154 184 33.3 Plus
Dper\GL15997-PA 175 GL15997-PA 110..169 84..143 177 50 Plus
Dper\GL19299-PA 159 GL19299-PA 66..156 54..155 150 35 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26105-PA 270 GA26105-PA 109..267 23..160 206 34.4 Plus
Dpse\GA25508-PA 301 GA25508-PA 229..299 92..162 196 46.5 Plus
Dpse\GA25513-PA 178 GA25513-PA 19..171 25..154 191 34 Plus
Dpse\GA26106-PA 186 GA26106-PA 111..181 84..154 185 46.5 Plus
Dpse\GA25907-PA 159 GA25907-PA 66..156 54..155 149 35 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18662-PA 176 GM18662-PA 19..176 1..162 729 87 Plus
Dsec\GM14026-PA 163 GM14026-PA 13..160 7..159 213 35.7 Plus
Dsec\GM18080-PA 164 GM18080-PA 65..149 76..160 201 41.2 Plus
Dsec\GM17169-PA 155 GM17169-PA 33..150 34..154 178 35.8 Plus
Dsec\GM17193-PA 156 GM17193-PA 73..145 84..156 154 37 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24047-PA 176 GD24047-PA 19..176 1..162 723 86.4 Plus
Dsim\GD22698-PA 164 GD22698-PA 65..149 76..160 205 42.4 Plus
Dsim\GD13307-PA 163 GD13307-PA 13..160 7..159 184 33.8 Plus
Dsim\GD21906-PA 155 GD21906-PA 33..150 34..154 176 35 Plus
Dsim\GD12443-PA 601 GD12443-PA 123..186 99..156 155 46.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11990-PA 229 GJ11990-PA 169..225 99..155 179 49.1 Plus
Dvir\GJ15380-PA 258 GJ15380-PA 184..253 86..155 164 44.3 Plus
Dvir\GJ13370-PA 108 GJ13370-PA 45..101 99..155 157 49.1 Plus
Dvir\GJ11989-PA 96 GJ11989-PA 36..96 99..159 155 44.3 Plus
Dvir\GJ12158-PA 680 GJ12158-PA 188..258 92..156 151 43.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19353-PA 135 GK19353-PA 12..130 33..160 162 30.1 Plus
Dwil\GK13567-PA 671 GK13567-PA 191..254 99..156 152 45.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20024-PA 176 GE20024-PA 41..171 25..156 317 50.8 Plus
Dyak\GE11876-PA 220 GE11876-PA 40..220 2..156 263 31.9 Plus
Dyak\GE20662-PA 164 GE20662-PA 14..161 1..159 202 37.1 Plus
Dyak\GE13175-PA 154 GE13175-PA 70..148 76..154 192 45.6 Plus
Dyak\GE14698-PA 263 GE14698-PA 152..232 83..160 189 39.5 Plus