Clone AT19071 Report

Search the DGRC for AT19071

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:190
Well:71
Vector:pOTB7
Associated Gene/TranscriptCG13110-RA
Protein status:AT19071.pep: gold
Preliminary Size:402
Sequenced Size:541

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13110 2001-12-16 Blastp of sequenced clone
CG13110 2002-01-01 Sim4 clustering to Release 2
CG13110 2003-01-01 Sim4 clustering to Release 3
CG13110 2008-04-29 Release 5.5 accounting
CG13110 2008-08-15 Release 5.9 accounting
CG13110 2008-12-18 5.12 accounting

Clone Sequence Records

AT19071.complete Sequence

541 bp (541 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070802

> AT19071.complete
CACGTAACACACTTTAGTTCATAAAAAATATATTTTCTAAAAAAAAACGG
AATTGCTGAACTGTGACAAAGATGCTCATTCCAGAGGTGGACATGTGGAA
TGTGTCCAAGAGTAGCCGGATACACCGCCTTTCCATCTTCAATTGCGATA
AGCCTGGACTGAAAGTGTTGGACTACGCCGCAGTCCGGGGAGTTGATAGG
TTCTACTTGGAGTGCCAGGACTACAGGGATTATTTCAAAGACCCCTATAA
TCGAGTCCACAAGCCGATAAGGTTCACCTCGTATGCGGGCAAGTGCGACG
TTAAGTTGGATACCGACGTTGAGGTCCTTTCTGAGCCGACCTTGTGGCGT
ATTGATCGCCAGCCCATCGTCTATCCGATCGACTATCACTCGGATATGGC
ACTGGGTAGACGGGACTGCGATCACATTAAAGCCTTTTGTTCGCCAGCTG
AGAGCCTAAGCTTCAAGCGATAGGTTGCTGTTGCCATTTTTGTCAGATTA
AATACAGTTTTAAGCATTGCAAAAAAAAAAAAAAAAAAAAA

AT19071.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG13110-RA 524 CG13110-RA 1..522 1..522 2505 98.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:51:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9349366..9349884 1..520 2490 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:53:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9350477..9350998 1..522 2505 98.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9350477..9350998 1..522 2505 98.6 Plus
Blast to na_te.dros performed on 2019-03-16 04:51:08 has no hits.

AT19071.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:52:03 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9349366..9349884 1..520 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:13:23 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
CG13110-RA 1..402 72..473 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:58:00 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
CG13110-RA 1..402 72..473 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:43:19 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
CG13110-RA 1..402 72..473 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:38:49 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
CG13110-RA 1..402 72..473 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:52:05 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
CG13110-RA 1..402 72..473 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:37:53 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
CG13110-RA 1..520 1..520 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:58:00 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
CG13110-RA 8..527 1..520 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:43:19 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
CG13110-RA 8..527 1..520 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:38:49 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
CG13110-RA 1..520 1..520 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:52:05 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
CG13110-RA 8..527 1..520 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:52:03 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9350477..9350996 1..520 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:52:03 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9350477..9350996 1..520 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:52:03 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9350477..9350996 1..520 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:43:19 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9350477..9350996 1..520 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:26 Download gff for AT19071.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9350477..9350996 1..520 98   Plus

AT19071.pep Sequence

Translation from 71 to 472

> AT19071.pep
MLIPEVDMWNVSKSSRIHRLSIFNCDKPGLKVLDYAAVRGVDRFYLECQD
YRDYFKDPYNRVHKPIRFTSYAGKCDVKLDTDVEVLSEPTLWRIDRQPIV
YPIDYHSDMALGRRDCDHIKAFCSPAESLSFKR*

AT19071.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22722-PA 133 GF22722-PA 1..133 1..133 379 55.6 Plus
Dana\GF15522-PA 140 GF15522-PA 9..140 3..133 266 38.6 Plus
Dana\GF17873-PA 136 GF17873-PA 6..113 3..109 220 40.7 Plus
Dana\GF17872-PA 135 GF17872-PA 5..135 3..133 216 38.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:43:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25343-PA 134 GG25343-PA 1..133 1..133 647 89.5 Plus
Dere\GG17104-PA 143 GG17104-PA 6..117 3..113 262 44.6 Plus
Dere\GG25288-PA 1312 GG25288-PA 6..93 3..89 237 50 Plus
Dere\GG17102-PA 135 GG17102-PA 5..116 3..112 229 42 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:43:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13601-PA 137 GH13601-PA 6..137 3..133 325 47.7 Plus
Dgri\GH19560-PA 135 GH19560-PA 6..115 3..111 250 40.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13110-PA 133 CG13110-PA 1..133 1..133 725 100 Plus
CG31347-PA 143 CG31347-PA 6..117 3..113 262 44.6 Plus
CG43796-PA 127 CG43796-PA 4..106 11..112 234 42.7 Plus
CG14391-PA 135 CG14391-PA 5..116 3..112 229 42 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17431-PA 137 GI17431-PA 6..137 3..133 317 47 Plus
Dmoj\GI22263-PA 135 GI22263-PA 6..135 3..133 243 39.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:43:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26142-PA 133 GL26142-PA 1..133 1..133 333 46.6 Plus
Dper\GL26141-PA 133 GL26141-PA 1..133 1..133 278 43.6 Plus
Dper\GL23114-PA 123 GL23114-PA 1..105 8..113 179 39.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:43:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12052-PA 133 GA12052-PA 1..133 1..133 333 46.6 Plus
Dpse\GA28678-PA 133 GA28678-PA 1..133 1..133 333 46.6 Plus
Dpse\GA25300-PA 138 GA25300-PA 7..138 3..133 284 41.7 Plus
Dpse\GA25307-PA 133 GA25307-PA 1..133 1..133 282 43.6 Plus
Dpse\GA27147-PB 132 GA27147-PB 5..114 3..113 193 40.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17435-PA 133 GM17435-PA 1..133 1..133 680 96.2 Plus
Dsec\GM25988-PA 143 GM25988-PA 6..117 3..113 264 44.6 Plus
Dsec\GM25986-PA 135 GM25986-PA 5..116 3..112 228 42 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23598-PA 133 GD23598-PA 1..133 1..133 692 97.7 Plus
Dsim\GD20548-PA 143 GD20548-PA 6..117 3..113 264 44.6 Plus
Dsim\GD20547-PA 135 GD20547-PA 5..116 3..112 230 42 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18378-PA 137 GJ18378-PA 6..137 3..133 324 46.2 Plus
Dvir\GJ24054-PA 135 GJ24054-PA 6..135 3..133 245 42.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18959-PA 128 GK18959-PA 1..107 1..110 262 44.5 Plus
Dwil\GK24199-PA 134 GK24199-PA 1..134 1..133 243 37.8 Plus
Dwil\GK24173-PA 1339 GK24173-PA 1..82 8..88 203 45.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:43:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18835-PA 133 GE18835-PA 1..133 1..133 660 91 Plus
Dyak\GE18778-PA 137 GE18778-PA 6..137 3..133 267 41.7 Plus
Dyak\GE24493-PA 143 GE24493-PA 6..117 3..113 264 44.6 Plus
Dyak\GE24492-PA 135 GE24492-PA 5..116 3..112 229 42 Plus

AT19071.hyp Sequence

Translation from 71 to 472

> AT19071.hyp
MLIPEVDMWNVSKSSRIHRLSIFNCDKPGLKVLDYAAVRGVDRFYLECQD
YRDYFKDPYNRVHKPIRFTSYAGKCDVKLDTDVEVLSEPTLWRIDRQPIV
YPIDYHSDMALGRRDCDHIKAFCSPAESLSFKR*

AT19071.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13110-PA 133 CG13110-PA 1..133 1..133 725 100 Plus
CG31347-PA 143 CG31347-PA 6..117 3..113 262 44.6 Plus
CG43796-PA 127 CG43796-PA 4..106 11..112 234 42.7 Plus
CG14391-PA 135 CG14391-PA 5..116 3..112 229 42 Plus