Clone AT19154 Report

Search the DGRC for AT19154

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:191
Well:54
Vector:pOTB7
Associated Gene/TranscriptScox-RA
Protein status:AT19154.pep: gold
Preliminary Size:885
Sequenced Size:999

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8885 2002-01-01 Sim4 clustering to Release 2
CG8885 2002-02-22 Blastp of sequenced clone
CG8885 2003-01-01 Sim4 clustering to Release 3
CG8885 2008-04-29 Release 5.5 accounting
CG8885 2008-08-15 Release 5.9 accounting
CG8885 2008-12-18 5.12 accounting

Clone Sequence Records

AT19154.complete Sequence

999 bp (999 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089369

> AT19154.complete
GTAAAGCCTTCAAATTTCTGAAACCGGGCGTAAGATGTCCCGCTCCCTGC
AACGCTTAGTGGGCAGCTGTCGTCGCTGGGCACAACAGCCCGCAATTCGT
CATTATGCCGCTCCCGCAGATTCCACTAAAGGCAAGGGTCCGATCTCTTG
GAGAAGTCTGGCCGTCATTGGAGCCCTTGGAGCCGGAGGAGTGGGCTTCA
TGCTGTACGTGAAGAGCGAGAAGGATGAGGCGAGAATGAAGGAGCGTCAG
CGGCAATTGGGAAAAGCAGCCATCGGCGGCAGTTGGGAATTAGTTGATTC
GCAGGGAGCTGTTCGCAAATCGGAGGACTTCTTAGGCAAGTGGCTGCTCA
TCTATTTTGGCTTCACCCACTGCCCGGATATTTGTCCCGATGAGCTAGAG
AAGATGGCCGCCGTCGTCGATGAAGTTGAAAAGTCCCCGCAAACGCCAGC
AGTGCAGCCCATCTTTATCACCGTTGACCCAGAACGTGACTCCAAAGAGG
TGGTGGCCAAATACGTAAAAGAGTTCTCCCCCAAACTGCTGGGACTCACG
GGAACCGTCGAACAAATCCGCAAAGTGTGCAAGGCCTTCAGGGTTTATTT
CAGCGCTGGACCGCGGGACGAGGACAACGATTATATTGTGGATCACACCA
TCATCATGTACCTGGTCAATCCCGATGGCGAGTTTGTCGATTACTACGGC
CAAAATCGGGACAAGGACCAGTGTGTGGCATCCATTTTGGTGAACATAGC
CAAGTGGAATTCAATGAACAAAAAGGGATGGTTCAGCTAGGCTGGCTAAG
CTAGGCAAATGTTGTTTCGTTGTATTTACTTAATGTATGGCATAAAATAT
GGTTTTTACTTGATGTATATCAAGTTTTAAATCCAAATTTTCGTTTATAT
TGGCTATACCTTAAGTTCTAGATTGTAAAAATTTCTGGTTGTTCAAAATA
AACTTGATTAACGGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT19154.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8885-RA 1042 CG8885-RA 78..1042 1..965 4825 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4966932..4967469 965..428 2690 100 Minus
chr2L 23010047 chr2L 4967532..4967959 428..1 2140 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:53:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4967831..4968369 966..428 2695 100 Minus
2L 23513712 2L 4968432..4968859 428..1 2140 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4967831..4968369 966..428 2695 100 Minus
2L 23513712 2L 4968432..4968859 428..1 2140 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:47:08 has no hits.

AT19154.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:47:57 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4966932..4967468 429..965 100 <- Minus
chr2L 4967532..4967959 1..428 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:13:35 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
CG8885-RA 1..756 35..790 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:41:37 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
Scox-RA 1..756 35..790 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:26:47 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
Scox-RA 1..756 35..790 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:10:44 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
CG8885-RA 1..756 35..790 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:50:52 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
Scox-RA 1..756 35..790 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:06:25 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
CG8885-RA 78..1042 1..965 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:41:37 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
Scox-RA 78..1042 1..965 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:26:47 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
Scox-RA 77..1041 1..965 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:10:44 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
CG8885-RA 78..1042 1..965 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:50:52 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
Scox-RA 77..1041 1..965 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:57 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4967832..4968368 429..965 100 <- Minus
2L 4968432..4968859 1..428 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:57 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4967832..4968368 429..965 100 <- Minus
2L 4968432..4968859 1..428 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:57 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4967832..4968368 429..965 100 <- Minus
2L 4968432..4968859 1..428 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:26:47 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4967832..4968368 429..965 100 <- Minus
arm_2L 4968432..4968859 1..428 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:45:07 Download gff for AT19154.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4967832..4968368 429..965 100 <- Minus
2L 4968432..4968859 1..428 100   Minus

AT19154.hyp Sequence

Translation from 34 to 789

> AT19154.hyp
MSRSLQRLVGSCRRWAQQPAIRHYAAPADSTKGKGPISWRSLAVIGALGA
GGVGFMLYVKSEKDEARMKERQRQLGKAAIGGSWELVDSQGAVRKSEDFL
GKWLLIYFGFTHCPDICPDELEKMAAVVDEVEKSPQTPAVQPIFITVDPE
RDSKEVVAKYVKEFSPKLLGLTGTVEQIRKVCKAFRVYFSAGPRDEDNDY
IVDHTIIMYLVNPDGEFVDYYGQNRDKDQCVASILVNIAKWNSMNKKGWF
S*

AT19154.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
Scox-PA 251 CG8885-PA 1..251 1..251 1326 100 Plus

AT19154.pep Sequence

Translation from 34 to 789

> AT19154.pep
MSRSLQRLVGSCRRWAQQPAIRHYAAPADSTKGKGPISWRSLAVIGALGA
GGVGFMLYVKSEKDEARMKERQRQLGKAAIGGSWELVDSQGAVRKSEDFL
GKWLLIYFGFTHCPDICPDELEKMAAVVDEVEKSPQTPAVQPIFITVDPE
RDSKEVVAKYVKEFSPKLLGLTGTVEQIRKVCKAFRVYFSAGPRDEDNDY
IVDHTIIMYLVNPDGEFVDYYGQNRDKDQCVASILVNIAKWNSMNKKGWF
S*

AT19154.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23635-PA 251 GF23635-PA 1..251 1..251 1270 91.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24334-PA 251 GG24334-PA 1..251 1..251 1325 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10243-PA 262 GH10243-PA 1..262 1..251 1178 85.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
Scox-PA 251 CG8885-PA 1..251 1..251 1326 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15364-PA 250 GI15364-PA 1..250 1..251 1171 86.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26535-PA 254 GL26535-PA 1..254 1..251 1134 88.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21389-PA 254 GA21389-PA 1..254 1..251 1134 88.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18054-PA 251 GM18054-PA 1..251 1..251 1343 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22674-PA 251 GD22674-PA 1..251 1..251 1334 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17274-PA 255 GJ17274-PA 1..255 1..251 1134 85.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24460-PA 256 GK24460-PA 1..256 1..251 1184 87.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18713-PA 251 GE18713-PA 1..251 1..251 1315 98 Plus