Clone AT19180 Report

Search the DGRC for AT19180

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:191
Well:80
Vector:pOTB7
Associated Gene/TranscriptCG11291-RA
Protein status:AT19180.pep: validated not full length
Preliminary Size:747
Sequenced Size:1269

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11291 2002-01-01 Sim4 clustering to Release 2
CG11291 2002-02-22 Blastp of sequenced clone
CG11291 2003-01-01 Sim4 clustering to Release 3
CG11291 2008-04-29 Release 5.5 accounting
CG11291 2008-08-15 Release 5.9 accounting
CG11291 2008-12-18 5.12 accounting

Clone Sequence Records

AT19180.complete Sequence

1269 bp (1269 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089370

> AT19180.complete
TTAAGGCGCAGTCTAAGCCATCTGGACAAGCTGCCGAAGGCAAAGGTGGC
CGAATGGCTGGCCGGGATCGACACCATTATTTGCAGCACGGATGGGGTGC
TGTGGCAGGAGAATACCCCCATTGAGGGCTCTGTAGAGGCATTCAATGCC
ATAATTTCAAAGGGAAAGCGATGTCTCATAGCCACCAACGAGTGCTGCCT
AACAAACAAGGATCTGTTCCAGAAGGCCAAGTGCCTGGGCTTCAATGTCA
AGGAGCAGGACATTTTCAGCTCGTCGGGTGCCATTGCGAGTTACCTTAGC
GACCGGAAGTTTAAGAAGAAAATCCTCGTTTTGGGTGGTGACGGTATCCG
CAAAGATCTGAAAGAGGCCGGATTCTGTTCCGTGGTAAACGATCTGCAGC
CAAATGACCAGAAAAAAATCGACTTCGTCAGGAGCTTAGTTCTCGATCCG
GATGTGGGAGCTGTTTTGGTGGCCAGAGACGACAACATGATAGCGAACGA
GTTGCTTGTGGCCTGCAACTATCTTCAAAATCCCAAAGTCTTGTTCCTTA
CCACTTGCATTGATGGATTCCAGCCATTTGGGAAAAAGAGGATCCCAGAT
GCCGGATCTCTGGCCTCTGCCATCGAGATAATTGTACAACGCAAGCCTAT
CGTTTTGGGCAAACCGAATCAGCGGATTTTGGGCAAGTTGATGAAGTCTG
GCGAAATAAAGCCCGAAAAGACGCTTGTCATTGGAAACTCGCTTAAATCA
GACATTTTATTTGCAAGTATATGTGGTTTCCAATCATTATTGGTGGGCTG
CGATAACGGAGCGATCGAAAAAGCCGAGAAAATTAAAAAAGAGGGAGATG
AGAAGAAAATGAAACTTGTTCCAGATGCTTTTCTCTCCGGTCTTGCTTCT
TTTGGGGAGTATTTATGCATCTAGGTGATGTCGGGCAAGAAAAGCGATTT
CCATATCCAAAAAACATACCCAGCTGACCAAAAAGTAATTTAGATCATAT
TCAAAATTCAAACTAAGCCGCTCAAAAGCTGAACAGCTGTTTTGTTTCTG
AGCACTCCTGTGTGCTAAATGATTTCGGTATTTTGGCTTTTAGCACAAGT
CGCGAGTCAGTGCTACCAGTATATTTGTAAATTTTTAGTTTTAAAATTTG
TAATCTAAAATAGTAAAGCAAATTGCCAGTTTTCTGTTGAAACTAATAGT
TTTGCATTATACACTGAAACGAACATTTTCAATAAATAACTTTTAGGACA
AAAAAAAAAAAAAAAAAAA

AT19180.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG11291-RA 1340 CG11291-RA 74..1280 1..1207 6035 100 Plus
CG31459-RA 1039 CG31459-RA 992..1037 1207..1252 230 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18098035..18098775 1..741 3660 99.6 Plus
chr2R 21145070 chr2R 18098829..18099292 741..1204 2200 98.3 Plus
chr3R 27901430 chr3R 15665901..15665943 1207..1249 215 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:53:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22211444..22212184 1..741 3705 100 Plus
2R 25286936 2R 22212238..22212704 741..1207 2335 100 Plus
3R 32079331 3R 19841998..19842043 1207..1252 230 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22212643..22213383 1..741 3705 100 Plus
2R 25260384 2R 22213437..22213903 741..1207 2335 100 Plus
3R 31820162 3R 19582829..19582874 1207..1252 230 100 Plus
Blast to na_te.dros performed 2019-03-15 19:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Paris 1730 Dvir\Paris TV1 1730bp Derived from Z49253. 716..779 922..860 119 67.2 Minus

AT19180.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:03:34 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18098035..18098774 1..740 99 -> Plus
chr2R 18098829..18099303 741..1221 96 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:13:40 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
CG11291-RA 4..927 1..924 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:41:39 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
CG11291-RA 4..927 1..924 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:39:42 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
CG11291-RA 4..927 1..924 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:10:45 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
CG11291-RA 4..927 1..924 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:08:03 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
CG11291-RA 4..927 1..924 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:06:27 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
CG11291-RA 4..1210 1..1207 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:41:39 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
CG11291-RA 4..1210 1..1207 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:39:42 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
CG11291-RA 74..1280 1..1207 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:10:45 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
CG11291-RA 4..1210 1..1207 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:08:03 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
CG11291-RA 74..1280 1..1207 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:34 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22211444..22212183 1..740 100 -> Plus
2R 22212238..22212712 741..1220 98 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:34 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22211444..22212183 1..740 100 -> Plus
2R 22212238..22212712 741..1220 98 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:34 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22211444..22212183 1..740 100 -> Plus
2R 22212238..22212712 741..1220 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:39:42 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18098949..18099688 1..740 100 -> Plus
arm_2R 18099743..18100217 741..1220 98 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:45:08 Download gff for AT19180.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22212643..22213382 1..740 100 -> Plus
2R 22213437..22213911 741..1220 98 -> Plus

AT19180.pep Sequence

Translation from 0 to 923

> AT19180.pep
LRRSLSHLDKLPKAKVAEWLAGIDTIICSTDGVLWQENTPIEGSVEAFNA
IISKGKRCLIATNECCLTNKDLFQKAKCLGFNVKEQDIFSSSGAIASYLS
DRKFKKKILVLGGDGIRKDLKEAGFCSVVNDLQPNDQKKIDFVRSLVLDP
DVGAVLVARDDNMIANELLVACNYLQNPKVLFLTTCIDGFQPFGKKRIPD
AGSLASAIEIIVQRKPIVLGKPNQRILGKLMKSGEIKPEKTLVIGNSLKS
DILFASICGFQSLLVGCDNGAIEKAEKIKKEGDEKKMKLVPDAFLSGLAS
FGEYLCI*

AT19180.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12617-PA 318 GF12617-PA 2..305 1..306 755 47.4 Plus
Dana\GF10231-PA 308 GF10231-PA 2..308 1..306 536 36.4 Plus
Dana\GF25232-PA 316 GF25232-PA 3..301 2..299 515 36.8 Plus
Dana\GF10230-PA 309 GF10230-PA 5..272 1..266 459 37.6 Plus
Dana\GF25233-PA 315 GF25233-PA 9..315 8..305 407 33.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22174-PA 314 GG22174-PA 2..308 1..307 1417 88.6 Plus
Dere\GG14490-PA 307 GG14490-PA 2..307 1..306 622 38.4 Plus
Dere\GG15774-PA 315 GG15774-PA 3..301 2..299 515 36.5 Plus
Dere\GG14489-PA 320 GG14489-PA 19..315 11..305 480 35.4 Plus
Dere\GG15776-PA 315 GG15776-PA 3..309 2..299 411 35 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:48:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14576-PA 309 GH14576-PA 2..309 1..306 610 39 Plus
Dgri\GH14574-PA 319 GH14574-PA 8..314 1..305 515 36.9 Plus
Dgri\GH23184-PA 319 GH23184-PA 8..314 1..305 508 36.5 Plus
Dgri\GH14463-PA 316 GH14463-PA 3..301 2..299 475 34.3 Plus
Dgri\GH14464-PA 314 GH14464-PA 2..314 1..305 324 31.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG11291-PA 308 CG11291-PA 2..308 1..307 1570 100 Plus
CG32488-PB 307 CG32488-PB 3..307 2..306 599 39.2 Plus
CG32488-PA 307 CG32488-PA 3..307 2..306 599 39.2 Plus
CG5567-PA 330 CG5567-PA 18..315 2..298 517 37.2 Plus
CG32487-PA 320 CG32487-PA 19..315 11..305 461 35.9 Plus
CG5577-PB 315 CG5577-PB 9..308 8..298 376 34 Plus
CG5577-PA 315 CG5577-PA 9..308 8..298 376 34 Plus
CG10352-PB 315 CG10352-PB 3..280 4..278 285 30.2 Plus
CG15739-PB 308 CG15739-PB 6..300 7..305 273 25.7 Plus
CG15739-PA 308 CG15739-PA 6..300 7..305 273 25.7 Plus
CG2680-PB 305 CG2680-PB 6..300 7..305 184 26.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:48:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13900-PA 307 GI13900-PA 2..307 1..305 641 40.8 Plus
Dmoj\GI13899-PA 314 GI13899-PA 3..309 1..305 563 38.8 Plus
Dmoj\GI13608-PA 316 GI13608-PA 3..301 2..299 462 33.9 Plus
Dmoj\GI13609-PA 310 GI13609-PA 10..310 8..305 389 33.9 Plus
Dmoj\GI10972-PA 323 GI10972-PA 20..285 7..267 258 27.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17529-PA 336 GL17529-PA 2..308 1..306 751 49.2 Plus
Dper\GL13742-PA 308 GL13742-PA 2..308 1..306 627 40.2 Plus
Dper\GL16692-PA 317 GL16692-PA 2..306 1..304 608 39.5 Plus
Dper\GL18198-PA 305 GL18198-PA 2..305 1..306 605 39.9 Plus
Dper\GL22743-PA 314 GL22743-PA 5..305 2..301 486 36.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24194-PA 336 GA24194-PA 2..308 1..306 742 48.9 Plus
Dpse\GA16942-PA 308 GA16942-PA 2..308 1..306 630 40.2 Plus
Dpse\GA18976-PA 314 GA18976-PA 5..305 2..301 486 36.1 Plus
Dpse\GA16941-PA 321 GA16941-PA 25..310 16..299 447 34.3 Plus
Dpse\GA18982-PA 313 GA18982-PA 12..281 11..266 357 33.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14093-PA 307 GM14093-PA 2..307 1..306 619 38.4 Plus
Dsec\GM24299-PA 315 GM24299-PA 3..301 2..299 518 36.8 Plus
Dsec\GM14092-PA 320 GM14092-PA 9..315 1..305 467 34.7 Plus
Dsec\GM24300-PA 315 GM24300-PA 9..309 8..299 384 33.8 Plus
Dsec\GM15895-PA 423 GM15895-PA 364..423 248..307 291 93.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11653-PA 308 GD11653-PA 2..308 1..307 1529 96.4 Plus
Dsim\GD13365-PA 307 GD13365-PA 2..307 1..306 620 38.8 Plus
Dsim\GD12368-PA 315 GD12368-PA 3..301 2..299 518 36.8 Plus
Dsim\GD13364-PA 320 GD13364-PA 9..315 1..305 467 34.7 Plus
Dsim\GD12369-PA 315 GD12369-PA 9..309 8..299 383 33.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11757-PA 308 GJ11757-PA 2..308 1..306 650 42.1 Plus
Dvir\GJ11756-PA 321 GJ11756-PA 10..316 1..305 577 39.7 Plus
Dvir\GJ13944-PA 316 GJ13944-PA 3..301 2..299 448 33.3 Plus
Dvir\GJ13945-PA 310 GJ13945-PA 10..310 8..305 381 32.9 Plus
Dvir\GJ18530-PA 311 GJ18530-PA 4..303 3..306 278 26.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20804-PA 298 GK20804-PA 2..296 1..294 667 42 Plus
Dwil\GK17623-PA 311 GK17623-PA 2..311 1..306 648 40.6 Plus
Dwil\GK16579-PA 323 GK16579-PA 20..318 11..305 474 35 Plus
Dwil\GK21181-PA 318 GK21181-PA 5..303 2..299 462 33.1 Plus
Dwil\GK10443-PA 313 GK10443-PA 2..313 1..305 352 30.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14167-PA 311 GE14167-PA 2..306 1..305 1451 90.8 Plus
Dyak\GE21679-PA 307 GE21679-PA 2..307 1..306 631 39.4 Plus
Dyak\GE22109-PA 315 GE22109-PA 3..301 2..299 512 36.1 Plus
Dyak\GE21678-PA 320 GE21678-PA 19..315 11..305 474 35.4 Plus
Dyak\GE22110-PA 315 GE22110-PA 9..308 8..298 389 33.7 Plus

AT19180.hyp Sequence

Translation from 1 to 923

> AT19180.hyp
LRRSLSHLDKLPKAKVAEWLAGIDTIICSTDGVLWQENTPIEGSVEAFNA
IISKGKRCLIATNECCLTNKDLFQKAKCLGFNVKEQDIFSSSGAIASYLS
DRKFKKKILVLGGDGIRKDLKEAGFCSVVNDLQPNDQKKIDFVRSLVLDP
DVGAVLVARDDNMIANELLVACNYLQNPKVLFLTTCIDGFQPFGKKRIPD
AGSLASAIEIIVQRKPIVLGKPNQRILGKLMKSGEIKPEKTLVIGNSLKS
DILFASICGFQSLLVGCDNGAIEKAEKIKKEGDEKKMKLVPDAFLSGLAS
FGEYLCI*

AT19180.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG11291-PA 308 CG11291-PA 2..308 1..307 1570 100 Plus
CG32488-PB 307 CG32488-PB 3..307 2..306 599 39.2 Plus
CG32488-PA 307 CG32488-PA 3..307 2..306 599 39.2 Plus
CG5567-PA 330 CG5567-PA 18..315 2..298 517 37.2 Plus
CG32487-PA 320 CG32487-PA 19..315 11..305 461 35.9 Plus