Clone AT19485 Report

Search the DGRC for AT19485

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:194
Well:85
Vector:pOTB7
Associated Gene/TranscriptCG2887-RA
Protein status:AT19485.pep: gold
Preliminary Size:1029
Sequenced Size:1252

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2887 2001-12-16 Blastp of sequenced clone
CG2887 2002-01-01 Sim4 clustering to Release 2
CG2887 2003-01-01 Sim4 clustering to Release 3
CG2887 2008-04-29 Release 5.5 accounting
CG2887 2008-08-15 Release 5.9 accounting
CG2887 2008-12-18 5.12 accounting

Clone Sequence Records

AT19485.complete Sequence

1252 bp (1252 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070804

> AT19485.complete
AATTCAATTAAATTTTCGAAGGAGTTGCACTTGTTCGTCTGTGTACGTAA
AACATTTGGAGTAAAAAACCATGCCTAAAGACTACTACAAGATACTGGGC
ATCCAGCGCACTGCCAATGATGGCGAAATCCGCAAGGCATATCATAAGCA
AGCGCTGCGCTACCATCCGGACAAAAACAAGAGCCCTCAGGCGGAGGAGA
TCTTTAAGCAGGTGGCCAAGGCATATGAAGTCCTATCAGACAAAAAGAAG
CGCGGATCGTACGACTCCCGCAATGACAAGGGTACCCGACGCAATACCGC
GAATCAAGGTAGCGGTTTCGGCGATGGAACGGCATTTGGTAGCTGTGGTG
GTGGCAGTGGCAGTGGCAGTGGCGGTGGCAGTGGCGGTGGTCGCCAGAAC
AACCCGCGGGCCAACTTTGGACGTTTCTTCGACAACAGCGAATCATATTC
TACGTTCTTCGAGGATATCGAAAACGATTTTGACAGCGACGATGACGTCC
TGTTGGGTGGAGGAGCGGGCGCGCCTAAACGTCGTTGCGAACAACAGTCA
CCCCAGTCAAGCATCGAACATGTAATATACGTTGCTCTGGAGGACATTGC
CAACGGGTGCAACAGGCGCATGAAGATCTCCCGGGCTTCGGGTAGGAACG
GCGTTGATGGGGTACAATATGACAGAATTCTCACTGTCAAGATACCTCCG
GGCTGTAAGGCTGGCACCAAGATCTGCTTTCCCAATGAGGGTATTCAACT
GCCCAACCTTGAGCCCGCCAACGTCGTGTTTATAATCCGGGACAAGCCAC
ACCCAATCTTTCGCCGCGATGGCAACAATCTGCTGTACACAGCCGAAATC
TCGCTGAAGGATGCTCTGTGCGGTTTACACGTGATGGTGCCGACGCTTCT
TGGCAGGCCGATGGAACTCAAGACCGACGTGGGCGAGGTAATCAGTCCGA
AATCCGTGCGCCGCATTCTGGGCTACGGATTGCCCGATTCCATTAATAAT
TCCCGTCGCGGCTCCATCGTCGTCAGGTTCTCCATCCAGTTTCCAGACGC
CATATCCAAAGAACTCGCATCCTCGCTCGACAGACTTCTGCAAAACTGAT
CGAATGGACACCTGGAGATGTTATCCGTCTTTATGAACGGATCAACGGAT
CATACATACAACAAAAAATCATCTGTGCTCCACATAAAATTACATATTTT
TTTTCTATGTGATTCAATAAAGATCTTATAATCTAAAAAAAAAAAAAAAA
AA

AT19485.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG2887-RA 1236 CG2887-RA 1..1235 1..1235 6160 99.9 Plus
DnaJ-1-RA 2018 DnaJ-1-RA 483..576 161..254 230 82.9 Plus
DnaJ-1-RB 2209 DnaJ-1-RB 728..821 161..254 230 82.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10368758..10369991 1234..1 6155 99.9 Minus
chr3L 24539361 chr3L 5743949..5744126 254..77 245 75.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:53:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10477259..10478493 1235..1 6160 99.9 Minus
3L 28110227 3L 5751410..5751587 254..77 245 75.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10485357..10486591 1235..1 6160 99.9 Minus
3L 28103327 3L 5744510..5744603 254..161 230 82.9 Minus
Blast to na_te.dros performed on 2019-03-16 12:10:50 has no hits.

AT19485.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:11:47 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10368758..10369991 1..1234 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:14:06 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
CG2887-RA 1..1029 71..1099 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:53 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
CG2887-RA 1..1029 71..1099 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:19:38 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
CG2887-RA 1..1029 71..1099 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:26 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
CG2887-RA 1..1029 71..1099 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:39:52 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
CG2887-RA 1..1029 71..1099 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:23 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
CG2887-RA 1..1234 1..1234 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:53 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
CG2887-RA 1..1234 1..1234 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:19:38 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
CG2887-RA 1..1234 1..1234 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:26 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
CG2887-RA 1..1234 1..1234 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:39:52 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
CG2887-RA 1..1234 1..1234 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:47 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
X 10477260..10478493 1..1234 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:47 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
X 10477260..10478493 1..1234 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:11:47 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
X 10477260..10478493 1..1234 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:19:38 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10371293..10372526 1..1234 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:02:09 Download gff for AT19485.complete
Subject Subject Range Query Range Percent Splice Strand
X 10485358..10486591 1..1234 99   Minus

AT19485.pep Sequence

Translation from 70 to 1098

> AT19485.pep
MPKDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAK
AYEVLSDKKKRGSYDSRNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGS
GGGSGGGRQNNPRANFGRFFDNSESYSTFFEDIENDFDSDDDVLLGGGAG
APKRRCEQQSPQSSIEHVIYVALEDIANGCNRRMKISRASGRNGVDGVQY
DRILTVKIPPGCKAGTKICFPNEGIQLPNLEPANVVFIIRDKPHPIFRRD
GNNLLYTAEISLKDALCGLHVMVPTLLGRPMELKTDVGEVISPKSVRRIL
GYGLPDSINNSRRGSIVVRFSIQFPDAISKELASSLDRLLQN*

AT19485.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:19:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19555-PA 334 GF19555-PA 1..334 1..342 806 52.3 Plus
Dana\GF10450-PA 354 GF10450-PA 1..354 1..342 693 41.8 Plus
Dana\GF15175-PA 346 GF15175-PA 1..346 1..340 671 42.1 Plus
Dana\GF17599-PA 403 GF17599-PA 7..350 5..340 321 28.2 Plus
Dana\GF20662-PA 355 GF20662-PA 24..343 3..340 272 27 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:19:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18918-PA 332 GG18918-PA 1..332 1..342 1042 59.9 Plus
Dere\DnaJ-1-PA 351 GG14117-PA 1..351 1..342 708 43.3 Plus
Dere\GG24779-PA 350 GG24779-PA 1..350 1..340 662 40.8 Plus
Dere\GG19654-PA 403 GG19654-PA 7..350 5..340 344 27.1 Plus
Dere\GG10228-PA 389 GG10228-PA 7..344 6..339 260 28.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:19:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11404-PA 346 GH11404-PA 1..346 1..340 676 41 Plus
Dgri\GH15011-PA 353 GH15011-PA 1..353 1..342 640 41.6 Plus
Dgri\GH19043-PA 405 GH19043-PA 7..352 5..340 319 27.9 Plus
Dgri\GH10346-PA 397 GH10346-PA 5..328 4..325 271 27.8 Plus
Dgri\GH11226-PA 355 GH11226-PA 24..344 3..341 248 26.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG2887-PA 342 CG2887-PA 1..342 1..342 1793 100 Plus
DnaJ-1-PA 334 CG10578-PA 1..334 1..342 725 44.9 Plus
DnaJ-1-PB 334 CG10578-PB 1..334 1..342 725 44.9 Plus
CG5001-PC 346 CG5001-PC 1..335 1..329 659 41.7 Plus
CG5001-PD 350 CG5001-PD 1..339 1..329 655 41.2 Plus
CG5001-PA 350 CG5001-PA 1..339 1..329 655 41.2 Plus
CG5001-PB 350 CG5001-PB 1..339 1..329 655 41.2 Plus
Droj2-PE 403 CG8863-PE 7..350 5..340 378 29.3 Plus
Droj2-PD 403 CG8863-PD 7..350 5..340 378 29.3 Plus
Droj2-PC 403 CG8863-PC 7..350 5..340 378 29.3 Plus
Droj2-PB 403 CG8863-PB 7..350 5..340 378 29.3 Plus
Droj2-PA 403 CG8863-PA 7..350 5..340 378 29.3 Plus
shv-PA 354 CG4164-PA 24..342 3..340 287 27.4 Plus
DnaJ-H-PA 389 CG9828-PA 7..344 6..339 259 28.2 Plus
DnaJ-H-PB 389 CG9828-PB 7..344 6..339 259 28.2 Plus
DnaJ-H-PC 440 CG9828-PC 7..344 6..339 259 28.2 Plus
CG7130-PA 128 CG7130-PA 1..73 1..73 227 56.2 Plus
mrj-PG 346 CG8448-PG 3..145 4..129 226 37.7 Plus
mrj-PH 346 CG8448-PH 3..145 4..129 226 37.7 Plus
mrj-PE 346 CG8448-PE 3..145 4..129 226 37.7 Plus
l(2)tid-PE 445 CG5504-PE 62..188 1..132 208 38.8 Plus
l(2)tid-PA 447 CG5504-PA 62..188 1..132 208 38.8 Plus
l(2)tid-PC 507 CG5504-PC 62..188 1..132 208 38.8 Plus
l(2)tid-PD 514 CG5504-PD 62..188 1..132 208 38.8 Plus
l(2)tid-PB 520 CG5504-PB 62..188 1..132 208 38.8 Plus
CG12020-PA 366 CG12020-PA 7..339 4..332 206 24.3 Plus
CG3061-PA 370 CG3061-PA 105..184 3..82 201 48.8 Plus
mrj-PA 259 CG8448-PA 3..154 4..118 195 34.2 Plus
mrj-PC 259 CG8448-PC 3..154 4..118 195 34.2 Plus
mrj-PB 259 CG8448-PB 3..154 4..118 195 34.2 Plus
mrj-PD 259 CG8448-PD 3..154 4..118 195 34.2 Plus
CG32641-PA 132 CG32641-PA 1..91 1..91 189 42.9 Plus
CG32640-PA 132 CG32640-PA 1..91 1..91 189 42.9 Plus
Tpr2-PE 464 CG4599-PE 357..429 3..69 188 53.4 Plus
Tpr2-PB 464 CG4599-PB 357..429 3..69 188 53.4 Plus
Tpr2-PC 478 CG4599-PC 371..443 3..69 188 53.4 Plus
Tpr2-PD 508 CG4599-PD 401..473 3..69 188 53.4 Plus
Tpr2-PA 508 CG4599-PA 401..473 3..69 188 53.4 Plus
CG2790-PA 540 CG2790-PA 4..105 5..102 184 41.2 Plus
CG30156-PB 358 CG30156-PB 95..157 3..65 163 46 Plus
CG30156-PA 358 CG30156-PA 95..157 3..65 163 46 Plus
P58IPK-PA 498 CG8286-PA 395..489 3..96 160 41.2 Plus
Csp-PA 223 CG6395-PA 19..85 6..71 156 46.3 Plus
Csp-PC 228 CG6395-PC 19..85 6..71 156 46.3 Plus
Csp-PE 244 CG6395-PE 19..85 6..71 156 46.3 Plus
Csp-PD 244 CG6395-PD 19..85 6..71 156 46.3 Plus
Csp-PF 249 CG6395-PF 19..85 6..71 156 46.3 Plus
Csp-PB 249 CG6395-PB 19..85 6..71 156 46.3 Plus
CG7387-PA 449 CG7387-PA 96..161 1..65 156 47 Plus
CG8531-PA 545 CG8531-PA 12..88 1..73 153 41.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:19:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15199-PA 325 GI15199-PA 1..324 1..342 755 47.2 Plus
Dmoj\GI14539-PA 347 GI14539-PA 1..347 1..340 665 42.1 Plus
Dmoj\GI13174-PA 352 GI13174-PA 1..352 1..342 662 42.3 Plus
Dmoj\GI21690-PA 355 GI21690-PA 24..344 3..341 262 26.9 Plus
Dmoj\Tes40-PA 380 GI21193-PA 5..335 4..340 253 26.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15626-PA 318 GL15626-PA 1..309 1..305 595 40.5 Plus
Dper\GL16659-PA 158 GL16659-PA 1..158 184..342 371 47.8 Plus
Dper\GL24472-PA 404 GL24472-PA 7..351 5..340 347 29.1 Plus
Dper\GL20776-PA 230 GL20776-PA 1..129 1..152 273 43.4 Plus
Dper\GL24772-PA 392 GL24772-PA 5..327 4..326 268 27.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10408-PA 353 GA10408-PA 1..353 1..342 680 42.5 Plus
Dpse\GA18584-PA 346 GA18584-PA 1..346 1..340 670 40.3 Plus
Dpse\GA21376-PA 404 GA21376-PA 7..351 5..340 345 28.8 Plus
Dpse\GA22062-PA 392 GA22062-PA 5..327 4..326 268 27.9 Plus
Dpse\GA17999-PA 355 GA17999-PA 24..343 3..340 262 27.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:19:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11309-PA 344 GM11309-PA 1..342 1..340 1268 77.5 Plus
Dsec\DnaJ-1-PA 337 GM13903-PA 1..337 1..342 715 44.7 Plus
Dsec\GM16806-PA 350 GM16806-PA 1..350 1..340 665 40.8 Plus
Dsec\GM16745-PA 354 GM16745-PA 24..342 3..340 258 26.5 Plus
Dsec\GM22099-PA 128 GM22099-PA 1..73 1..73 227 57.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16032-PA 300 GD16032-PA 1..298 1..340 1058 64.2 Plus
Dsim\DnaJ-1-PA 352 GD13179-PA 1..352 1..342 691 43.5 Plus
Dsim\GD23083-PA 346 GD23083-PA 1..346 1..340 669 41.3 Plus
Dsim\GD18906-PA 403 GD18906-PA 7..350 5..340 320 28.2 Plus
Dsim\GD12075-PA 128 GD12075-PA 1..73 1..73 227 57.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14805-PA 325 GJ14805-PA 1..324 1..342 734 47.2 Plus
Dvir\GJ11949-PA 351 GJ11949-PA 1..351 1..342 671 41.8 Plus
Dvir\GJ16971-PA 347 GJ16971-PA 1..347 1..340 664 41.3 Plus
Dvir\GJ10422-PA 403 GJ10422-PA 7..350 5..340 328 28.8 Plus
Dvir\GJ10994-PA 393 GJ10994-PA 5..343 4..340 268 27.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19767-PA 330 GK19767-PA 1..330 1..342 757 48 Plus
Dwil\GK16875-PA 356 GK16875-PA 1..356 1..342 715 42.4 Plus
Dwil\GK15183-PA 346 GK15183-PA 1..346 1..340 682 41.3 Plus
Dwil\GK10421-PA 316 GK10421-PA 1..316 1..342 657 42.1 Plus
Dwil\GK13941-PA 403 GK13941-PA 7..350 5..340 326 26.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\DnaJ-1-PA 351 GE20542-PA 1..351 1..342 708 43.3 Plus
Dyak\GE17451-PA 350 GE17451-PA 1..350 1..340 662 40.8 Plus
Dyak\GE26270-PA 403 GE26270-PA 7..350 5..340 324 28.5 Plus
Dyak\GE16847-PA 354 GE16847-PA 24..342 3..340 261 26.7 Plus
Dyak\GE11908-PA 389 GE11908-PA 7..344 6..339 257 28.4 Plus

AT19485.hyp Sequence

Translation from 70 to 1098

> AT19485.hyp
MPKDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAK
AYEVLSDKKKRGSYDSRNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGS
GGGSGGGRQNNPRANFGRFFDNSESYSTFFEDIENDFDSDDDVLLGGGAG
APKRRCEQQSPQSSIEHVIYVALEDIANGCNRRMKISRASGRNGVDGVQY
DRILTVKIPPGCKAGTKICFPNEGIQLPNLEPANVVFIIRDKPHPIFRRD
GNNLLYTAEISLKDALCGLHVMVPTLLGRPMELKTDVGEVISPKSVRRIL
GYGLPDSINNSRRGSIVVRFSIQFPDAISKELASSLDRLLQN*

AT19485.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG2887-PA 342 CG2887-PA 1..342 1..342 1793 100 Plus
DnaJ-1-PA 334 CG10578-PA 1..334 1..342 725 44.9 Plus
DnaJ-1-PB 334 CG10578-PB 1..334 1..342 725 44.9 Plus
CG5001-PC 346 CG5001-PC 1..335 1..329 659 41.7 Plus
CG5001-PD 350 CG5001-PD 1..339 1..329 655 41.2 Plus