AT19560.complete Sequence
1408 bp (1408 high quality bases) assembled on 2004-03-05
GenBank Submission: BT012329
> AT19560.complete
AAATATTAGATGCCAAAATTTTCGTAGCGAGACTCCCGAAGAGCCTCTTT
TCAAAACTATGCTTTTAATAAGGAGTCTAGTAATTGTGTTTTTAGTAGCG
ATAAGCGAGTTCGATCGAAACTTTGCCATAAACCATGACAATGCTGGAAT
AGTTCTAAGGGAAATAAACAAGAGAAGAGATCGCCATGGAGTCCCAAAAT
TGACATTGGACAACGTGCTCAGTAAGGGATGCCAAAGTTATGCTTGGAAA
CTGTCCAAGTCGGCGACTCTTAACTATTCGGACCCCACTAACAAGGATTA
CACAGAAAGCATCTGCAGATTTGAAGTAAAGAGGGGAGCACTGTCGAGAT
GTGTCAAGAACTGGTATAATGGAAGGAAGTTCGATATTTTAGACCCCAAG
GCTAAAGATTTTACTGCCATGATTTGGAGGTCGTCCGTTTCCTTGGGATA
TGGCGACGCTAACATAAATTTTTCTTCGTTGGCACATCGTAGGCACCGAA
CGCTCGGACATGTTCCCTGATTCGGACCGCATTGATGGCGATAAATCCAC
CGGCATCCTGCGGCACATAGCCACCATGGACGTCCATAGATACGAGCTGT
TCGTTGTAAAGAGCTCCCACATCCTTCGCCGCCTTTCGGGCGATGGCACG
GCAATAGCCTGGGGCCAGTTCCACGGTGACCTTCCCGGAGACCCGCTGCT
CGGCCAACTCGATACATTTACGGGCATAAATTGCCTCGGGACTGAACCAG
AAGCCATTGTACACGTAGTCGGCCATGCGATCCCGGAGAACCTGCTTGGT
GCGGAGTACTTCGCGGTCCAAAGCAAACACCTCGAGGTCCTGGTGGGCAG
CAAAGAGGATGGTGCCTCCAGGCGTCTCGTACACCCCCCCGGGACTTCAG
TCCCACAAAGCGATTTTCCACGATGTCAATCCGCCCAATGCCATATGATC
CGCCAAGCTTATTGAGGAAATCTAGCATCTCCAGGGGTTTAGTGTAGACC
CGACCGCCGGGCAAATCCTCCACACTGGAGGGCAGTCCCCGATCAAATTG
AATGACCAAGTGAACCGGATCCCGTGGAGCCCTTGTCAGGGGATCGACTG
TCATCTCGTAGAGATTTTCCGGAGCCACTGTGTTGGGATCTTCGAGTATT
CCGGACTCGTAGCTGATGTGCAGGATGTTGGCATCGGTGCTCCAGGGTGT
GGCTGGCTTGGCGCTTACCTCGATTCCGTGTTGCTGGGCATAGGCAATGA
GGTCCTGTCGACCTTGAAACTGGCAGCAGAATTCTACATCCCTCCAGGGA
GCGATGATCTGGAAAAAAGTCGATTTCGCGTTTATAGCACAGTCAAATCT
TTAAATTTGATCACATATGTATATTAAATTTCTATTTTCTAAAAAAAAAA
AAAAAAAA
AT19560.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:03:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31286-RC | 1435 | CG31286-RC | 33..1422 | 1..1391 | 6915 | 99.9 | Plus |
CG31286-RB | 1945 | CG31286-RB | 1007..1932 | 465..1391 | 4580 | 99.7 | Plus |
CG1315-RA | 1331 | CG1315-RA | 457..1297 | 1310..469 | 4170 | 99.8 | Minus |
CG31286-RB | 1945 | CG31286-RB | 142..610 | 1..469 | 2345 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:43:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 2468207..2469127 | 469..1390 | 4560 | 99.9 | Plus |
chr3R | 27901430 | chr3R | 2467414..2467635 | 247..468 | 1110 | 100 | Plus |
chr3R | 27901430 | chr3R | 2467219..2467358 | 108..247 | 700 | 100 | Plus |
chr3R | 27901430 | chr3R | 2467057..2467165 | 1..109 | 545 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:54:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:43:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 6642414..6643335 | 469..1391 | 4565 | 99.9 | Plus |
3R | 32079331 | 3R | 6641621..6641842 | 247..468 | 1110 | 100 | Plus |
3R | 32079331 | 3R | 6641426..6641565 | 108..247 | 700 | 100 | Plus |
3R | 32079331 | 3R | 6641264..6641372 | 1..109 | 545 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:51:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 6383245..6384166 | 469..1391 | 4575 | 99.8 | Plus |
3R | 31820162 | 3R | 6382452..6382673 | 247..468 | 1110 | 100 | Plus |
3R | 31820162 | 3R | 6382257..6382396 | 108..247 | 700 | 100 | Plus |
3R | 31820162 | 3R | 6382095..6382203 | 1..109 | 545 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 00:43:18 has no hits.
AT19560.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:44:14 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 2467415..2467635 | 248..468 | 100 | -> | Plus |
chr3R | 2467057..2467165 | 1..109 | 100 | -> | Plus |
chr3R | 2467221..2467358 | 110..247 | 100 | -> | Plus |
chr3R | 2468207..2469127 | 469..1390 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:14:18 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31286-RC | 1..462 | 59..520 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:39:33 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31286-RB | 1..418 | 59..477 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:57:56 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31286-RB | 1..418 | 59..477 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:23:17 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31286-RC | 1..462 | 59..520 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:12:05 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31286-RB | 1..418 | 59..477 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:47:56 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31286-RC | 33..1421 | 1..1390 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:39:33 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31286-RB | 33..501 | 1..468 | 99 | -> | Plus |
CG31286-RB | 902..1822 | 469..1390 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:57:56 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31286-RB | 33..501 | 1..468 | 99 | -> | Plus |
CG31286-RB | 902..1822 | 469..1390 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:23:18 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31286-RC | 33..1421 | 1..1390 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:12:05 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31286-RB | 33..501 | 1..468 | 99 | -> | Plus |
CG31286-RB | 902..1822 | 469..1390 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:44:14 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 6641264..6641372 | 1..109 | 100 | -> | Plus |
3R | 6641428..6641565 | 110..247 | 100 | -> | Plus |
3R | 6641622..6641842 | 248..468 | 100 | -> | Plus |
3R | 6642414..6643334 | 469..1390 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:44:14 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 6641264..6641372 | 1..109 | 100 | -> | Plus |
3R | 6641428..6641565 | 110..247 | 100 | -> | Plus |
3R | 6641622..6641842 | 248..468 | 100 | -> | Plus |
3R | 6642414..6643334 | 469..1390 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:44:14 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 6641264..6641372 | 1..109 | 100 | -> | Plus |
3R | 6641428..6641565 | 110..247 | 100 | -> | Plus |
3R | 6641622..6641842 | 248..468 | 100 | -> | Plus |
3R | 6642414..6643334 | 469..1390 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:57:56 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 2466986..2467094 | 1..109 | 100 | -> | Plus |
arm_3R | 2467150..2467287 | 110..247 | 100 | -> | Plus |
arm_3R | 2467344..2467564 | 248..468 | 100 | -> | Plus |
arm_3R | 2468136..2469056 | 469..1390 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:00:45 Download gff for
AT19560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 6382453..6382673 | 248..468 | 100 | -> | Plus |
3R | 6383245..6384165 | 469..1390 | 99 | | Plus |
3R | 6382095..6382203 | 1..109 | 100 | -> | Plus |
3R | 6382259..6382396 | 110..247 | 100 | -> | Plus |
AT19560.hyp Sequence
Translation from 1 to 519
> AT19560.hyp
NIRCQNFRSETPEEPLFKTMLLIRSLVIVFLVAISEFDRNFAINHDNAGI
VLREINKRRDRHGVPKLTLDNVLSKGCQSYAWKLSKSATLNYSDPTNKDY
TESICRFEVKRGALSRCVKNWYNGRKFDILDPKAKDFTAMIWRSSVSLGY
GDANINFSSLAHRRHRTLGHVP*
AT19560.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:06:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31286-PB | 205 | CG31286-PB | 1..137 | 20..156 | 718 | 100 | Plus |
CG31482-PA | 195 | CG31482-PA | 1..130 | 20..153 | 174 | 29.5 | Plus |
CG32313-PB | 182 | CG32313-PB | 5..153 | 27..171 | 141 | 30.3 | Plus |
CG32313-PA | 181 | CG32313-PA | 5..152 | 27..171 | 140 | 31 | Plus |
AT19560.pep Sequence
Translation from 58 to 519
> AT19560.pep
MLLIRSLVIVFLVAISEFDRNFAINHDNAGIVLREINKRRDRHGVPKLTL
DNVLSKGCQSYAWKLSKSATLNYSDPTNKDYTESICRFEVKRGALSRCVK
NWYNGRKFDILDPKAKDFTAMIWRSSVSLGYGDANINFSSLAHRRHRTLG
HVP*
AT19560.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:37:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF18369-PA | 173 | GF18369-PA | 26..128 | 33..134 | 163 | 36.4 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:37:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13579-PA | 196 | GG13579-PA | 1..196 | 1..153 | 574 | 60.6 | Plus |
Dere\GG13534-PA | 197 | GG13534-PA | 1..130 | 1..134 | 174 | 30.2 | Plus |
Dere\GG14591-PA | 217 | GG14591-PA | 5..152 | 8..152 | 151 | 29 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31286-PB | 205 | CG31286-PB | 1..137 | 1..137 | 718 | 100 | Plus |
CG31482-PA | 195 | CG31482-PA | 1..130 | 1..134 | 174 | 29.5 | Plus |
CG32313-PB | 182 | CG32313-PB | 5..153 | 8..152 | 141 | 30.3 | Plus |
CG32313-PA | 181 | CG32313-PA | 5..152 | 8..152 | 140 | 31 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:37:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL23728-PA | 166 | GL23728-PA | 30..125 | 37..132 | 135 | 36.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:37:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA25572-PA | 201 | GA25572-PA | 30..125 | 37..132 | 144 | 37.3 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:37:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM10906-PA | 205 | GM10906-PA | 1..137 | 1..137 | 662 | 92 | Plus |
Dsec\GM10902-PA | 247 | GM10902-PA | 79..182 | 33..134 | 172 | 32.7 | Plus |
Dsec\GM14205-PA | 218 | GM14205-PA | 5..152 | 8..152 | 144 | 31 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:37:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19885-PA | 205 | GD19885-PA | 1..137 | 1..137 | 663 | 92 | Plus |
Dsim\GD19881-PA | 184 | GD19881-PA | 16..119 | 33..134 | 171 | 32.7 | Plus |
Dsim\GD13468-PA | 218 | GD13468-PA | 5..152 | 8..152 | 147 | 31.6 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:37:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ10085-PA | 194 | GJ10085-PA | 61..162 | 32..134 | 145 | 34.9 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:37:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK11578-PA | 150 | GK11578-PA | 12..115 | 32..132 | 147 | 33 | Plus |
Dwil\GK11171-PA | 172 | GK11171-PA | 36..134 | 32..130 | 141 | 38.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:37:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE10233-PA | 207 | GE10233-PA | 1..137 | 1..137 | 586 | 80.3 | Plus |
Dyak\GE10229-PA | 193 | GE10229-PA | 1..129 | 1..134 | 158 | 30.9 | Plus |
Dyak\GE10228-PA | 193 | GE10228-PA | 27..129 | 33..134 | 157 | 33.6 | Plus |
Dyak\GE20951-PA | 217 | GE20951-PA | 5..152 | 8..152 | 148 | 31 | Plus |