Clone AT19560 Report

Search the DGRC for AT19560

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:195
Well:60
Vector:pOTB7
Associated Gene/TranscriptCG31286-RC
Protein status:AT19560.pep: validated full length
Sequenced Size:1408

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31286 2004-03-05 Blastp of sequenced clone
CG31286 2008-04-29 Release 5.5 accounting
CG31286 2008-08-15 Release 5.9 accounting
CG1315 2008-08-15 Release 5.9 accounting
CG31286 2008-12-18 5.12 accounting
CG1315 2008-12-18 5.12 accounting

Clone Sequence Records

AT19560.complete Sequence

1408 bp (1408 high quality bases) assembled on 2004-03-05

GenBank Submission: BT012329

> AT19560.complete
AAATATTAGATGCCAAAATTTTCGTAGCGAGACTCCCGAAGAGCCTCTTT
TCAAAACTATGCTTTTAATAAGGAGTCTAGTAATTGTGTTTTTAGTAGCG
ATAAGCGAGTTCGATCGAAACTTTGCCATAAACCATGACAATGCTGGAAT
AGTTCTAAGGGAAATAAACAAGAGAAGAGATCGCCATGGAGTCCCAAAAT
TGACATTGGACAACGTGCTCAGTAAGGGATGCCAAAGTTATGCTTGGAAA
CTGTCCAAGTCGGCGACTCTTAACTATTCGGACCCCACTAACAAGGATTA
CACAGAAAGCATCTGCAGATTTGAAGTAAAGAGGGGAGCACTGTCGAGAT
GTGTCAAGAACTGGTATAATGGAAGGAAGTTCGATATTTTAGACCCCAAG
GCTAAAGATTTTACTGCCATGATTTGGAGGTCGTCCGTTTCCTTGGGATA
TGGCGACGCTAACATAAATTTTTCTTCGTTGGCACATCGTAGGCACCGAA
CGCTCGGACATGTTCCCTGATTCGGACCGCATTGATGGCGATAAATCCAC
CGGCATCCTGCGGCACATAGCCACCATGGACGTCCATAGATACGAGCTGT
TCGTTGTAAAGAGCTCCCACATCCTTCGCCGCCTTTCGGGCGATGGCACG
GCAATAGCCTGGGGCCAGTTCCACGGTGACCTTCCCGGAGACCCGCTGCT
CGGCCAACTCGATACATTTACGGGCATAAATTGCCTCGGGACTGAACCAG
AAGCCATTGTACACGTAGTCGGCCATGCGATCCCGGAGAACCTGCTTGGT
GCGGAGTACTTCGCGGTCCAAAGCAAACACCTCGAGGTCCTGGTGGGCAG
CAAAGAGGATGGTGCCTCCAGGCGTCTCGTACACCCCCCCGGGACTTCAG
TCCCACAAAGCGATTTTCCACGATGTCAATCCGCCCAATGCCATATGATC
CGCCAAGCTTATTGAGGAAATCTAGCATCTCCAGGGGTTTAGTGTAGACC
CGACCGCCGGGCAAATCCTCCACACTGGAGGGCAGTCCCCGATCAAATTG
AATGACCAAGTGAACCGGATCCCGTGGAGCCCTTGTCAGGGGATCGACTG
TCATCTCGTAGAGATTTTCCGGAGCCACTGTGTTGGGATCTTCGAGTATT
CCGGACTCGTAGCTGATGTGCAGGATGTTGGCATCGGTGCTCCAGGGTGT
GGCTGGCTTGGCGCTTACCTCGATTCCGTGTTGCTGGGCATAGGCAATGA
GGTCCTGTCGACCTTGAAACTGGCAGCAGAATTCTACATCCCTCCAGGGA
GCGATGATCTGGAAAAAAGTCGATTTCGCGTTTATAGCACAGTCAAATCT
TTAAATTTGATCACATATGTATATTAAATTTCTATTTTCTAAAAAAAAAA
AAAAAAAA

AT19560.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG31286-RC 1435 CG31286-RC 33..1422 1..1391 6915 99.9 Plus
CG31286-RB 1945 CG31286-RB 1007..1932 465..1391 4580 99.7 Plus
CG1315-RA 1331 CG1315-RA 457..1297 1310..469 4170 99.8 Minus
CG31286-RB 1945 CG31286-RB 142..610 1..469 2345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2468207..2469127 469..1390 4560 99.9 Plus
chr3R 27901430 chr3R 2467414..2467635 247..468 1110 100 Plus
chr3R 27901430 chr3R 2467219..2467358 108..247 700 100 Plus
chr3R 27901430 chr3R 2467057..2467165 1..109 545 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:54:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6642414..6643335 469..1391 4565 99.9 Plus
3R 32079331 3R 6641621..6641842 247..468 1110 100 Plus
3R 32079331 3R 6641426..6641565 108..247 700 100 Plus
3R 32079331 3R 6641264..6641372 1..109 545 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6383245..6384166 469..1391 4575 99.8 Plus
3R 31820162 3R 6382452..6382673 247..468 1110 100 Plus
3R 31820162 3R 6382257..6382396 108..247 700 100 Plus
3R 31820162 3R 6382095..6382203 1..109 545 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:43:18 has no hits.

AT19560.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:44:14 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2467415..2467635 248..468 100 -> Plus
chr3R 2467057..2467165 1..109 100 -> Plus
chr3R 2467221..2467358 110..247 100 -> Plus
chr3R 2468207..2469127 469..1390 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:14:18 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
CG31286-RC 1..462 59..520 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:39:33 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
CG31286-RB 1..418 59..477 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:57:56 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
CG31286-RB 1..418 59..477 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:23:17 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
CG31286-RC 1..462 59..520 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:12:05 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
CG31286-RB 1..418 59..477 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:47:56 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
CG31286-RC 33..1421 1..1390 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:39:33 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
CG31286-RB 33..501 1..468 99 -> Plus
CG31286-RB 902..1822 469..1390 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:57:56 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
CG31286-RB 33..501 1..468 99 -> Plus
CG31286-RB 902..1822 469..1390 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:23:18 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
CG31286-RC 33..1421 1..1390 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:12:05 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
CG31286-RB 33..501 1..468 99 -> Plus
CG31286-RB 902..1822 469..1390 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:44:14 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6641264..6641372 1..109 100 -> Plus
3R 6641428..6641565 110..247 100 -> Plus
3R 6641622..6641842 248..468 100 -> Plus
3R 6642414..6643334 469..1390 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:44:14 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6641264..6641372 1..109 100 -> Plus
3R 6641428..6641565 110..247 100 -> Plus
3R 6641622..6641842 248..468 100 -> Plus
3R 6642414..6643334 469..1390 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:44:14 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6641264..6641372 1..109 100 -> Plus
3R 6641428..6641565 110..247 100 -> Plus
3R 6641622..6641842 248..468 100 -> Plus
3R 6642414..6643334 469..1390 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:57:56 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2466986..2467094 1..109 100 -> Plus
arm_3R 2467150..2467287 110..247 100 -> Plus
arm_3R 2467344..2467564 248..468 100 -> Plus
arm_3R 2468136..2469056 469..1390 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:00:45 Download gff for AT19560.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6382453..6382673 248..468 100 -> Plus
3R 6383245..6384165 469..1390 99   Plus
3R 6382095..6382203 1..109 100 -> Plus
3R 6382259..6382396 110..247 100 -> Plus

AT19560.hyp Sequence

Translation from 1 to 519

> AT19560.hyp
NIRCQNFRSETPEEPLFKTMLLIRSLVIVFLVAISEFDRNFAINHDNAGI
VLREINKRRDRHGVPKLTLDNVLSKGCQSYAWKLSKSATLNYSDPTNKDY
TESICRFEVKRGALSRCVKNWYNGRKFDILDPKAKDFTAMIWRSSVSLGY
GDANINFSSLAHRRHRTLGHVP*

AT19560.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG31286-PB 205 CG31286-PB 1..137 20..156 718 100 Plus
CG31482-PA 195 CG31482-PA 1..130 20..153 174 29.5 Plus
CG32313-PB 182 CG32313-PB 5..153 27..171 141 30.3 Plus
CG32313-PA 181 CG32313-PA 5..152 27..171 140 31 Plus

AT19560.pep Sequence

Translation from 58 to 519

> AT19560.pep
MLLIRSLVIVFLVAISEFDRNFAINHDNAGIVLREINKRRDRHGVPKLTL
DNVLSKGCQSYAWKLSKSATLNYSDPTNKDYTESICRFEVKRGALSRCVK
NWYNGRKFDILDPKAKDFTAMIWRSSVSLGYGDANINFSSLAHRRHRTLG
HVP*

AT19560.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18369-PA 173 GF18369-PA 26..128 33..134 163 36.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13579-PA 196 GG13579-PA 1..196 1..153 574 60.6 Plus
Dere\GG13534-PA 197 GG13534-PA 1..130 1..134 174 30.2 Plus
Dere\GG14591-PA 217 GG14591-PA 5..152 8..152 151 29 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG31286-PB 205 CG31286-PB 1..137 1..137 718 100 Plus
CG31482-PA 195 CG31482-PA 1..130 1..134 174 29.5 Plus
CG32313-PB 182 CG32313-PB 5..153 8..152 141 30.3 Plus
CG32313-PA 181 CG32313-PA 5..152 8..152 140 31 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23728-PA 166 GL23728-PA 30..125 37..132 135 36.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25572-PA 201 GA25572-PA 30..125 37..132 144 37.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10906-PA 205 GM10906-PA 1..137 1..137 662 92 Plus
Dsec\GM10902-PA 247 GM10902-PA 79..182 33..134 172 32.7 Plus
Dsec\GM14205-PA 218 GM14205-PA 5..152 8..152 144 31 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19885-PA 205 GD19885-PA 1..137 1..137 663 92 Plus
Dsim\GD19881-PA 184 GD19881-PA 16..119 33..134 171 32.7 Plus
Dsim\GD13468-PA 218 GD13468-PA 5..152 8..152 147 31.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10085-PA 194 GJ10085-PA 61..162 32..134 145 34.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11578-PA 150 GK11578-PA 12..115 32..132 147 33 Plus
Dwil\GK11171-PA 172 GK11171-PA 36..134 32..130 141 38.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10233-PA 207 GE10233-PA 1..137 1..137 586 80.3 Plus
Dyak\GE10229-PA 193 GE10229-PA 1..129 1..134 158 30.9 Plus
Dyak\GE10228-PA 193 GE10228-PA 27..129 33..134 157 33.6 Plus
Dyak\GE20951-PA 217 GE20951-PA 5..152 8..152 148 31 Plus