Clone AT19988 Report

Search the DGRC for AT19988

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:199
Well:88
Vector:pOTB7
Associated Gene/TranscriptCG14262-RA
Protein status:AT19988.pep: gold
Preliminary Size:939
Sequenced Size:1012

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14262 2002-01-01 Sim4 clustering to Release 2
CG14262 2002-01-03 Blastp of sequenced clone
CG14262 2003-01-01 Sim4 clustering to Release 3
CG14262 2008-04-29 Release 5.5 accounting
CG14262 2008-08-15 Release 5.9 accounting
CG14262 2008-12-18 5.12 accounting

Clone Sequence Records

AT19988.complete Sequence

1012 bp (1012 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075240

> AT19988.complete
GTTTCCCTGGCAGGAATGTCAGACTCTGAGAAGGAGGCCGCCGGCAAAGC
CCACCTGGGAAGCAACAATCGGTGGTCCGACCTGGAGGAGGAGGAGGAGG
GTGAGGCGAACGACCAGGGAGGGATCCAGAACTTGAGGCCGGAACTCGTT
GTGCCCAGAACCACAGCTGCATCGGATGTTGAGGAGAATTTACCATTGGG
TTCTCCGAGTGATGGGTCCAAACGCGCTACGAGTAGAAACCGCAGACTGG
AATACTTTCGCAGTGGAGCCGATGCCGATTGCCAGGTGCACGTCCTGAGC
AACTGCCCCCAATCCGATGAGCCGGCGGTCAGTGTGTGCTACAAGAAGTT
TGGCTGCCATCGGATCTTCCTGGCCACCGCCTCCGACAAACTGGAGCAGG
ACGTGTACCAGAACAAGGACTGGAACGGCGTACTCCAGATCAATGGGGTT
TCGCCCGAGAGCGTGGAGATCTTCCTGGAGTTCATATACACCTTCGAGGT
GACCTCGCCGCTGGTCCAGCTGAAGCTGGTGGGGGATATGTTCATCCTGT
CCTGCGCGTACAACATGCCGGAGCTCCTTCGCTCCTTTGCTGAGAAACTA
AAGGAGCAGGAATTGCCTCTGGATGGCATCTTTCCTGCCTTCGACCTAGC
ATTCCGGCATAACATCATCGATGTGGAGCGCGTTTGCATCGAGAAAATCA
TAGAGGAAGGCGCATCATTGATCCACGAACCCAGTTTAATGAAACTCCCG
GTCTATGCTCTAAACTACGCCATCCAGCACTGGCTGGTGGCGGATGCAGT
GCCTCCCGATGAACTCATCACGATTTTAAAGCAGTATCAGGAGATCAATG
AGATTACATTCGCCAACACGCAAAAATTCCCGCACTTCACCAAAATTATC
AAGTATTTCCCCAATGTTCTTCTGGACGCCGAGGGATTCATCAATCAAAA
CTAGAAAACTACTTGGAATTCCCAAAAGCTTCGCGCATAAAACCCAAAAA
AAAAAAAAAAAA

AT19988.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG14262-RA 1051 CG14262-RA 10..1020 1..1011 4980 99.5 Plus
CG14262.a 1041 CG14262.a 10..703 1..694 3440 99.7 Plus
CG14262.a 1041 CG14262.a 701..1010 702..1011 1505 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23087661..23088353 693..1 3465 100 Minus
chr3R 27901430 chr3R 23087306..23087609 995..692 1520 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:54:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27264729..27265421 693..1 3435 99.7 Minus
3R 32079331 3R 27264358..27264677 1011..692 1555 99.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27005560..27006252 693..1 3435 99.7 Minus
3R 31820162 3R 27005189..27005508 1011..692 1555 99 Minus
Blast to na_te.dros performed on 2019-03-16 15:58:39 has no hits.

AT19988.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:59:34 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23087306..23087607 694..995 100 <- Minus
chr3R 23087661..23088353 1..693 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:14:52 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
CG14262-RA 1..939 16..954 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:57:36 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
CG14262-RA 1..939 16..954 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:58:47 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
CG14262-RA 1..939 16..954 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:22:20 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
CG14262-RA 1..939 16..954 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:57:42 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
CG14262-RA 1..939 16..954 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:22:16 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
CG14262-RA 10..1004 1..995 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:57:35 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
CG14262-RA 10..1004 1..995 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:58:47 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
CG14262-RA 10..1004 1..995 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:22:20 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
CG14262-RA 10..1004 1..995 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:57:42 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
CG14262-RA 10..1004 1..995 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:34 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27264374..27264675 694..995 100 <- Minus
3R 27264729..27265421 1..693 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:34 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27264374..27264675 694..995 100 <- Minus
3R 27264729..27265421 1..693 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:34 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27264374..27264675 694..995 100 <- Minus
3R 27264729..27265421 1..693 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:58:47 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23090096..23090397 694..995 100 <- Minus
arm_3R 23090451..23091143 1..693 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:57:18 Download gff for AT19988.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27005205..27005506 694..995 100 <- Minus
3R 27005560..27006252 1..693 99   Minus

AT19988.hyp Sequence

Translation from 1 to 953

> AT19988.hyp
VSLAGMSDSEKEAAGKAHLGSNNRWSDLEEEEEGEANDQGGIQNLRPELV
VPRTTAASDVEENLPLGSPSDGSKRATSRNRRLEYFRSGADADCQVHVLS
NCPQSDEPAVSVCYKKFGCHRIFLATASDKLEQDVYQNKDWNGVLQINGV
SPESVEIFLEFIYTFEVTSPLVQLKLVGDMFILSCAYNMPELLRSFAEKL
KEQELPLDGIFPAFDLAFRHNIIDVERVCIEKIIEEGASLIHEPSLMKLP
VYALNYAIQHWLVADAVPPDELITILKQYQEINEITFANTQKFPHFTKII
KYFPNVLLDAEGFINQN*

AT19988.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14262-PA 312 CG14262-PA 1..312 6..317 1626 100 Plus
CG14260-PA 249 CG14260-PA 6..237 81..314 262 29.6 Plus
CG14260-PB 166 CG14260-PB 6..144 81..221 178 31.5 Plus

AT19988.pep Sequence

Translation from 15 to 953

> AT19988.pep
MSDSEKEAAGKAHLGSNNRWSDLEEEEEGEANDQGGIQNLRPELVVPRTT
AASDVEENLPLGSPSDGSKRATSRNRRLEYFRSGADADCQVHVLSNCPQS
DEPAVSVCYKKFGCHRIFLATASDKLEQDVYQNKDWNGVLQINGVSPESV
EIFLEFIYTFEVTSPLVQLKLVGDMFILSCAYNMPELLRSFAEKLKEQEL
PLDGIFPAFDLAFRHNIIDVERVCIEKIIEEGASLIHEPSLMKLPVYALN
YAIQHWLVADAVPPDELITILKQYQEINEITFANTQKFPHFTKIIKYFPN
VLLDAEGFINQN*

AT19988.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18717-PA 323 GF18717-PA 76..322 65..311 975 69.2 Plus
Dana\GF16280-PA 260 GF16280-PA 6..234 76..307 266 27.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12123-PA 319 GG12123-PA 1..319 1..312 1417 83.6 Plus
Dere\GG11540-PA 249 GG11540-PA 6..237 76..309 272 29.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21482-PA 274 GH21482-PA 10..272 51..312 866 61.2 Plus
Dgri\GH19505-PA 312 GH19505-PA 6..234 76..307 304 29.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14262-PA 312 CG14262-PA 1..312 1..312 1626 100 Plus
CG14260-PA 249 CG14260-PA 6..237 76..309 262 29.6 Plus
CG14260-PB 166 CG14260-PB 6..144 76..216 178 31.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10513-PA 298 GI10513-PA 58..294 72..309 815 60.5 Plus
Dmoj\GI22256-PA 265 GI22256-PA 6..219 76..293 290 29.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23048-PA 297 GL23048-PA 4..297 18..311 759 50.5 Plus
Dper\GL24485-PA 400 GL24485-PA 6..232 76..307 255 26.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12866-PA 297 GA12866-PA 4..297 18..311 766 50.8 Plus
Dpse\GA12865-PA 389 GA12865-PA 6..232 76..307 256 26.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10115-PA 318 GM10115-PA 1..318 1..312 1528 90.6 Plus
Dsec\GM10382-PA 249 GM10382-PA 6..237 76..309 270 30.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15079-PA 235 GD15079-PA 1..214 1..208 986 87.5 Plus
Dsim\GD15081-PA 71 GD15081-PA 1..71 242..312 361 94.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23194-PA 312 GJ23194-PA 74..311 73..311 844 63.2 Plus
Dvir\GJ24047-PA 340 GJ24047-PA 6..236 76..309 283 28.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22591-PA 276 GK22591-PA 25..275 61..311 929 66.1 Plus
Dwil\GK22575-PA 258 GK22575-PA 6..235 76..307 250 27.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10571-PA 317 GE10571-PA 1..317 1..312 1353 79.1 Plus
Dyak\GE23727-PA 249 GE23727-PA 6..237 76..309 272 30.4 Plus