Clone AT20009 Report

Search the DGRC for AT20009

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:200
Well:9
Vector:pOTB7
Associated Gene/Transcriptfbl-RC
Protein status:AT20009.pep: gold
Preliminary Size:1914
Sequenced Size:1559

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5725 2002-09-15 Blastp of sequenced clone
fbl 2008-04-29 Release 5.5 accounting
fbl 2008-08-15 Release 5.9 accounting
fbl 2008-12-18 5.12 accounting

Clone Sequence Records

AT20009.complete Sequence

1559 bp (1559 high quality bases) assembled on 2002-09-15

GenBank Submission: BT001335

> AT20009.complete
ACTAGCTAGAACAATATATCCTGCAAAAATATACCTTATGATCAATACTC
TGCCATTGCAGCGATGCCATGGTTTGGCATGGACATCGGCGGAACCCTCA
CCAAGCTGGTCTACTTCGAGCCCAAGGACATAACGCCGGATGAGCAGGAT
CGCGAGGCTGGCATTTTGCGGAATATCCGACGCTACTTGACCAAAAACTC
GGCGTACGGCAAAACCGGACATCGTGATACGCACCTACAGATGGACAATG
TCGAGATACGCAAAAGACGCGGCTCCTTGCATTTCATTCGCTTCCAGACC
ACGGACATGGGCAACTTCCTATCGCTTGCCAAGCAGAAGGGCATGGCCGA
GCTGGTGACCACGGTTTGTGCCACCGGCGGTGGCGCATTCAAGTTCGAGC
AGGATTTCCGCGACCAAGTCAACATGAAGCTGGCTAAATTCGACGAGCTG
GACACGCTCATCAAAGGCATTCTTTTCGCCGATCTGCATAATCGCACGGA
GTGCTACTACTACGAAAACGCACGTGACATTCTAAAAAGCGAAAAGCAGC
AGTTCAATTTCTCTCAACCGTTTCCGTTTATTCTGGTGAACGTCGGATCC
GGAGTCTCCATCCTGGCGGTCTACGGTCCCGACAACTACAAGCGGATTTC
GGGCACGAGCTTGGGCGGCGGTACATTCCTCGGCCTGTGTTGTCTACTCA
CCGGCTGCACATCCTTCGAAGAGGCCATCCAACTGGCCACCAAGGGTGAC
AATAGGAAGGTGGACAAGTTAGTTAAGGACATTTATGGTGGCGATTACAA
CCGCTTTGGTCTCCCCGGCGATTTGGTGGCGTCAAGCTTTGGCCAGATGC
ACCTCAACGACAAACGGGTTTCCGTATCACGCGAAGATCTGGCCAACGCC
ACTCTGGTCACCATAACGAATAATATCGGCTCCATAGCAAGGATGTGCGC
GCTGAATGAGAAGATCGATAGGGTCGTCTTTGTGGGCAACTTTCTGCGAG
TTAACCCCATTTCCATGAAGCTGCTGGCGTACGCAATGGAGTTCTGGTCC
AATGGCACAATGAAGGGTCTTTTCCTGGAGCACGAGGGATACTTTGGGGC
TCTGGGTTGCCTGCTGCAGTTCAACGGCGAGCTGGCAGCCGCCCTTAACG
ACGGAGTGGAGCATTCAATCCACACTGAATCCGATTCAGCAAGCGAAGCA
GCACAGACATCTTCTACGGCGGACGAGCCACCAGAAAAGGCGCCCACAAG
CAAACACTCCACTAGATAGTCGCTATAACCACATGTTCCTCCCAAGGGCA
CCCAACGTGCGCCAGCCGATTGAAGTGCATGTACAGTAGACCTAAGATCA
ATAAGGCAATGACAATGGCAGTGGCAATGACTTTGGTCCTTCGCAGTTCA
TCTCGGTATTTATCGTAATTCTTTCTCGGCTTTAGTTGTAACTTGATGAC
GCACAAATTGTAAATGCATGAAATTACGTATGTATGGATAAAGTGCCTGC
TAGAAAGCAACGAATTTTGGCCCGATCAAATGCCGAACCACAAAAAAAAA
AAAAAAAAA

AT20009.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
fbl.i 2053 fbl.i 53..1595 1..1543 7655 99.7 Plus
fbl-RD 1841 fbl-RD 53..1595 1..1543 7655 99.7 Plus
fbl-RA 2246 fbl-RA 518..2000 61..1543 7355 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20379942..20380511 972..1541 2835 99.8 Plus
chr3L 24539361 chr3L 20378970..20379265 238..533 1465 99.7 Plus
chr3L 24539361 chr3L 20377665..20377904 1..240 1200 100 Plus
chr3L 24539361 chr3L 20379513..20379691 658..836 895 100 Plus
chr3L 24539361 chr3L 20379745..20379884 835..974 700 100 Plus
chr3L 24539361 chr3L 20379325..20379450 534..659 630 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:54:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20390885..20391456 972..1543 2830 99.7 Plus
3L 28110227 3L 20389913..20390208 238..533 1465 99.7 Plus
3L 28110227 3L 20388608..20388847 1..240 1200 100 Plus
3L 28110227 3L 20390456..20390634 658..836 895 100 Plus
3L 28110227 3L 20390688..20390827 835..974 685 99.3 Plus
3L 28110227 3L 20390268..20390393 534..659 630 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20383985..20384556 972..1543 2830 99.6 Plus
3L 28103327 3L 20383013..20383308 238..533 1465 99.6 Plus
3L 28103327 3L 20381708..20381947 1..240 1200 100 Plus
3L 28103327 3L 20383556..20383734 658..836 895 100 Plus
3L 28103327 3L 20383788..20383927 835..974 685 99.2 Plus
3L 28103327 3L 20383368..20383493 534..659 630 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:21:53 has no hits.

AT20009.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:22:48 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20377665..20377904 1..240 100 -> Plus
chr3L 20378973..20379265 241..533 99 -> Plus
chr3L 20379325..20379450 534..659 100 -> Plus
chr3L 20379515..20379691 660..836 100 -> Plus
chr3L 20379747..20379882 837..972 100 -> Plus
chr3L 20379943..20380511 973..1541 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:14:54 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
fbl-RA 50..1260 58..1269 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:15:10 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
fbl-RA 50..1260 58..1269 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:42:13 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
fbl-RB 46..1254 61..1269 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:06:06 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
fbl-RA 50..1260 58..1269 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:01:34 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
fbl-RB 46..1254 61..1269 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:38:37 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
fbl-RD 1..1541 1..1541 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:15:10 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
fbl-RD 1..1541 1..1541 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:42:13 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
fbl-RD 1..1541 1..1541 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:06:07 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
fbl-RD 1..1541 1..1541 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:01:34 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
fbl-RD 1..1541 1..1541 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:48 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20388608..20388847 1..240 100 -> Plus
3L 20389916..20390208 241..533 99 -> Plus
3L 20390268..20390393 534..659 100 -> Plus
3L 20390458..20390634 660..836 100 -> Plus
3L 20390690..20390825 837..972 99 -> Plus
3L 20390886..20391454 973..1541 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:48 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20388608..20388847 1..240 100 -> Plus
3L 20389916..20390208 241..533 99 -> Plus
3L 20390268..20390393 534..659 100 -> Plus
3L 20390458..20390634 660..836 100 -> Plus
3L 20390690..20390825 837..972 99 -> Plus
3L 20390886..20391454 973..1541 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:48 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20388608..20388847 1..240 100 -> Plus
3L 20389916..20390208 241..533 99 -> Plus
3L 20390268..20390393 534..659 100 -> Plus
3L 20390458..20390634 660..836 100 -> Plus
3L 20390690..20390825 837..972 99 -> Plus
3L 20390886..20391454 973..1541 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:42:13 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20383790..20383925 837..972 99 -> Plus
arm_3L 20383016..20383308 241..533 99 -> Plus
arm_3L 20383368..20383493 534..659 100 -> Plus
arm_3L 20381708..20381947 1..240 100 -> Plus
arm_3L 20383558..20383734 660..836 100 -> Plus
arm_3L 20383986..20384554 973..1541 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:38:03 Download gff for AT20009.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20381708..20381947 1..240 100 -> Plus
3L 20383016..20383308 241..533 99 -> Plus
3L 20383368..20383493 534..659 100 -> Plus
3L 20383558..20383734 660..836 100 -> Plus
3L 20383790..20383925 837..972 99 -> Plus
3L 20383986..20384554 973..1541 99   Plus

AT20009.pep Sequence

Translation from 63 to 1268

> AT20009.pep
MPWFGMDIGGTLTKLVYFEPKDITPDEQDREAGILRNIRRYLTKNSAYGK
TGHRDTHLQMDNVEIRKRRGSLHFIRFQTTDMGNFLSLAKQKGMAELVTT
VCATGGGAFKFEQDFRDQVNMKLAKFDELDTLIKGILFADLHNRTECYYY
ENARDILKSEKQQFNFSQPFPFILVNVGSGVSILAVYGPDNYKRISGTSL
GGGTFLGLCCLLTGCTSFEEAIQLATKGDNRKVDKLVKDIYGGDYNRFGL
PGDLVASSFGQMHLNDKRVSVSREDLANATLVTITNNIGSIARMCALNEK
IDRVVFVGNFLRVNPISMKLLAYAMEFWSNGTMKGLFLEHEGYFGALGCL
LQFNGELAAALNDGVEHSIHTESDSASEAAQTSSTADEPPEKAPTSKHST
R*

AT20009.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10336-PA 529 GF10336-PA 129..529 1..401 2018 93.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16111-PA 512 GG16111-PA 113..512 1..401 2095 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16974-PA 531 GH16974-PA 124..516 1..394 1931 90.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
fbl-PG 428 CG5725-PG 28..428 1..401 2093 100 Plus
fbl-PE 512 CG5725-PE 112..512 1..401 2093 100 Plus
fbl-PC 401 CG5725-PC 1..401 1..401 2093 100 Plus
fbl-PA 419 CG5725-PA 19..419 1..401 2093 100 Plus
fbl-PB 417 CG5725-PB 17..417 1..401 2093 100 Plus
fbl-PD 401 CG5725-PD 1..401 1..401 2093 100 Plus
fbl-PF 342 CG5725-PF 1..342 60..401 1772 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11839-PA 523 GI11839-PA 123..522 1..395 1911 89.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11882-PA 537 GL11882-PA 128..537 1..401 2004 91.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19085-PA 537 GA19085-PA 128..537 1..401 2002 91.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22287-PA 512 GM22287-PA 112..512 1..401 2151 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14883-PA 512 GD14883-PA 112..512 1..401 2154 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13538-PA 528 GJ13538-PA 127..526 1..400 1932 89.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16961-PA 519 GK16961-PA 118..519 1..397 1948 90.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\fbl-PA 418 GE19678-PA 19..418 1..401 2113 98.3 Plus
Dyak\GE19675-PA 504 GE19675-PA 110..467 1..358 1933 99.7 Plus

AT20009.hyp Sequence

Translation from 63 to 1268

> AT20009.hyp
MPWFGMDIGGTLTKLVYFEPKDITPDEQDREAGILRNIRRYLTKNSAYGK
TGHRDTHLQMDNVEIRKRRGSLHFIRFQTTDMGNFLSLAKQKGMAELVTT
VCATGGGAFKFEQDFRDQVNMKLAKFDELDTLIKGILFADLHNRTECYYY
ENARDILKSEKQQFNFSQPFPFILVNVGSGVSILAVYGPDNYKRISGTSL
GGGTFLGLCCLLTGCTSFEEAIQLATKGDNRKVDKLVKDIYGGDYNRFGL
PGDLVASSFGQMHLNDKRVSVSREDLANATLVTITNNIGSIARMCALNEK
IDRVVFVGNFLRVNPISMKLLAYAMEFWSNGTMKGLFLEHEGYFGALGCL
LQFNGELAAALNDGVEHSIHTESDSASEAAQTSSTADEPPEKAPTSKHST
R*

AT20009.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
fbl-PC 401 CG5725-PC 1..401 1..401 2093 100 Plus
fbl-PD 401 CG5725-PD 1..401 1..401 2093 100 Plus
fbl-PB 417 CG5725-PB 17..417 1..401 2093 100 Plus
fbl-PA 419 CG5725-PA 19..419 1..401 2093 100 Plus
fbl-PG 428 CG5725-PG 28..428 1..401 2093 100 Plus