Clone AT20031 Report

Search the DGRC for AT20031

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:200
Well:31
Vector:pOTB7
Associated Gene/TranscriptCG31644-RA
Protein status:AT20031.pep: gold
Sequenced Size:448

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31644 2001-12-16 Blastp of sequenced clone
CG14005 2002-01-01 Sim4 clustering to Release 2
CG31644 2003-01-01 Sim4 clustering to Release 3
CG31644 2008-04-29 Release 5.5 accounting
CG31644 2008-08-15 Release 5.9 accounting
CG31644 2008-12-18 5.12 accounting

Clone Sequence Records

AT20031.complete Sequence

448 bp (448 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070808

> AT20031.complete
ACTCGAAAATGCCCGAAGAAAAGTTCAAGTTTCCCATGCATGACTTACAC
TTGAAGCAAACGTTTCGCAATGTAAAAATGGCCTGCACTTTGGCCCTGTT
AGCTCCACTTCTTTTCTACACTTTACACAACAATCCGCGCAAGAGGAAGT
ACAGGAACTTTTACTCCACTTACGATCCCATGGATGCGTTCGACCGCATG
ATGAGTGGAGGATACCTATCGTCCTGTCCGCCGGGCAGTGGTCCCAAAAA
GGATGACAAGAAGAAGAAATAGATCAAGGTACCGACAGTATCTTATCTCA
ATTCCCATTGAACACCATATAGACAAATTAACCATGTAACCCCTTGTCGA
CACACCTCCTAAATGGAAATCAAAATTTACATGAACTAGTTAACACATTG
CATTACAAATAAATTGGAGCATTGCAAACTAAAAAAAAAAAAAAAAAA

AT20031.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG31644-RA 620 CG31644-RA 138..568 1..431 2125 99.5 Plus
CG31644.a 552 CG31644.a 76..500 1..431 2025 98.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:05:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5816922..5817330 430..22 2030 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:54:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:04:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5817889..5818298 431..22 2020 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5817889..5818298 431..22 2020 99.5 Minus
Blast to na_te.dros performed on 2019-03-16 09:04:58 has no hits.

AT20031.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:05:42 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5816922..5817328 24..430 99 <- Minus
chr2L 5817403..5817425 1..23 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:15:00 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 1..264 9..272 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:39 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 1..264 9..272 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:55:47 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 1..264 9..272 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:12 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 1..264 9..272 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:58:55 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 1..264 9..272 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:05 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 1..428 1..428 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:39 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 1..428 1..428 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:55:47 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 51..480 1..430 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:12 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 1..428 1..428 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:58:55 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
CG31644-RA 51..480 1..430 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:05:42 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5817890..5818296 24..430 99 <- Minus
2L 5818371..5818393 1..23 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:05:42 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5817890..5818296 24..430 99 <- Minus
2L 5818371..5818393 1..23 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:05:42 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5817890..5818296 24..430 99 <- Minus
2L 5818371..5818393 1..23 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:55:47 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5817890..5818296 24..430 99 <- Minus
arm_2L 5818371..5818393 1..23 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:01:53 Download gff for AT20031.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5817890..5818296 24..430 99 <- Minus
2L 5818371..5818393 1..23 100   Minus

AT20031.hyp Sequence

Translation from 2 to 271

> AT20031.hyp
SKMPEEKFKFPMHDLHLKQTFRNVKMACTLALLAPLLFYTLHNNPRKRKY
RNFYSTYDPMDAFDRMMSGGYLSSCPPGSGPKKDDKKKK*

AT20031.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG31644-PA 87 CG31644-PA 1..87 3..89 479 100 Plus
CG31644-PC 90 CG31644-PC 1..90 3..89 465 96.7 Plus
CG31644-PB 85 CG31644-PB 1..85 3..89 455 97.7 Plus

AT20031.pep Sequence

Translation from 8 to 271

> AT20031.pep
MPEEKFKFPMHDLHLKQTFRNVKMACTLALLAPLLFYTLHNNPRKRKYRN
FYSTYDPMDAFDRMMSGGYLSSCPPGSGPKKDDKKKK*

AT20031.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14300-PA 96 GF14300-PA 8..81 5..78 266 64.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24280-PA 92 GG24280-PA 1..82 1..79 359 80.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10925-PA 99 GH10925-PA 9..80 2..73 258 63.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG31644-PA 87 CG31644-PA 1..87 1..87 479 100 Plus
CG31644-PC 90 CG31644-PC 1..90 1..87 465 96.7 Plus
CG31644-PB 85 CG31644-PB 1..85 1..87 455 97.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13379-PA 79 GI13379-PA 1..65 10..74 230 61.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19113-PA 94 GL19113-PA 9..78 6..75 290 72.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16361-PA 94 GA16361-PA 3..78 2..75 281 68.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17995-PA 91 GM17995-PA 1..82 1..79 368 84.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22629-PA 91 GD22629-PA 1..82 1..79 378 87.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12019-PA 55 GJ12019-PA 2..37 39..74 159 80.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19064-PA 95 GK19064-PA 11..84 5..78 310 74.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18976-PA 93 GE18976-PA 1..82 1..79 363 80.5 Plus