BDGP Sequence Production Resources |
Search the DGRC for AT20031
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 200 |
Well: | 31 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG31644-RA |
Protein status: | AT20031.pep: gold |
Sequenced Size: | 448 |
Gene | Date | Evidence |
---|---|---|
CG31644 | 2001-12-16 | Blastp of sequenced clone |
CG14005 | 2002-01-01 | Sim4 clustering to Release 2 |
CG31644 | 2003-01-01 | Sim4 clustering to Release 3 |
CG31644 | 2008-04-29 | Release 5.5 accounting |
CG31644 | 2008-08-15 | Release 5.9 accounting |
CG31644 | 2008-12-18 | 5.12 accounting |
448 bp (448 high quality bases) assembled on 2001-12-16
GenBank Submission: AY070808
> AT20031.complete ACTCGAAAATGCCCGAAGAAAAGTTCAAGTTTCCCATGCATGACTTACAC TTGAAGCAAACGTTTCGCAATGTAAAAATGGCCTGCACTTTGGCCCTGTT AGCTCCACTTCTTTTCTACACTTTACACAACAATCCGCGCAAGAGGAAGT ACAGGAACTTTTACTCCACTTACGATCCCATGGATGCGTTCGACCGCATG ATGAGTGGAGGATACCTATCGTCCTGTCCGCCGGGCAGTGGTCCCAAAAA GGATGACAAGAAGAAGAAATAGATCAAGGTACCGACAGTATCTTATCTCA ATTCCCATTGAACACCATATAGACAAATTAACCATGTAACCCCTTGTCGA CACACCTCCTAAATGGAAATCAAAATTTACATGAACTAGTTAACACATTG CATTACAAATAAATTGGAGCATTGCAAACTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 5816922..5817330 | 430..22 | 2030 | 99.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 5817889..5818298 | 431..22 | 2020 | 99.5 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 5817889..5818298 | 431..22 | 2020 | 99.5 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 5816922..5817328 | 24..430 | 99 | <- | Minus |
chr2L | 5817403..5817425 | 1..23 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31644-RA | 1..264 | 9..272 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31644-RA | 1..264 | 9..272 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31644-RA | 1..264 | 9..272 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31644-RA | 1..264 | 9..272 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31644-RA | 1..264 | 9..272 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31644-RA | 1..428 | 1..428 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31644-RA | 1..428 | 1..428 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31644-RA | 51..480 | 1..430 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31644-RA | 1..428 | 1..428 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31644-RA | 51..480 | 1..430 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5817890..5818296 | 24..430 | 99 | <- | Minus |
2L | 5818371..5818393 | 1..23 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5817890..5818296 | 24..430 | 99 | <- | Minus |
2L | 5818371..5818393 | 1..23 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5817890..5818296 | 24..430 | 99 | <- | Minus |
2L | 5818371..5818393 | 1..23 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 5817890..5818296 | 24..430 | 99 | <- | Minus |
arm_2L | 5818371..5818393 | 1..23 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5817890..5818296 | 24..430 | 99 | <- | Minus |
2L | 5818371..5818393 | 1..23 | 100 | Minus |
Translation from 2 to 271
> AT20031.hyp SKMPEEKFKFPMHDLHLKQTFRNVKMACTLALLAPLLFYTLHNNPRKRKY RNFYSTYDPMDAFDRMMSGGYLSSCPPGSGPKKDDKKKK*
Translation from 8 to 271
> AT20031.pep MPEEKFKFPMHDLHLKQTFRNVKMACTLALLAPLLFYTLHNNPRKRKYRN FYSTYDPMDAFDRMMSGGYLSSCPPGSGPKKDDKKKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14300-PA | 96 | GF14300-PA | 8..81 | 5..78 | 266 | 64.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24280-PA | 92 | GG24280-PA | 1..82 | 1..79 | 359 | 80.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10925-PA | 99 | GH10925-PA | 9..80 | 2..73 | 258 | 63.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31644-PA | 87 | CG31644-PA | 1..87 | 1..87 | 479 | 100 | Plus |
CG31644-PC | 90 | CG31644-PC | 1..90 | 1..87 | 465 | 96.7 | Plus |
CG31644-PB | 85 | CG31644-PB | 1..85 | 1..87 | 455 | 97.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13379-PA | 79 | GI13379-PA | 1..65 | 10..74 | 230 | 61.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19113-PA | 94 | GL19113-PA | 9..78 | 6..75 | 290 | 72.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16361-PA | 94 | GA16361-PA | 3..78 | 2..75 | 281 | 68.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17995-PA | 91 | GM17995-PA | 1..82 | 1..79 | 368 | 84.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD22629-PA | 91 | GD22629-PA | 1..82 | 1..79 | 378 | 87.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12019-PA | 55 | GJ12019-PA | 2..37 | 39..74 | 159 | 80.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19064-PA | 95 | GK19064-PA | 11..84 | 5..78 | 310 | 74.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18976-PA | 93 | GE18976-PA | 1..82 | 1..79 | 363 | 80.5 | Plus |