Clone AT20732 Report

Search the DGRC for AT20732

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:207
Well:32
Vector:pOTB7
Associated Gene/TranscriptCG33340-RA
Protein status:AT20732.pep: gold
Preliminary Size:1596
Sequenced Size:873

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33340 2004-01-09 Blastp of sequenced clone
CG33340 2008-04-29 Release 5.5 accounting
CG33340 2008-08-15 Release 5.9 accounting
CG33340 2008-12-18 5.12 accounting

Clone Sequence Records

AT20732.complete Sequence

873 bp (873 high quality bases) assembled on 2004-01-09

GenBank Submission: BT011405

> AT20732.complete
CTCGAGCTGGATAGGTCTCTAGCCTCCCAGTTTCGTGTTCGCAAAATTCC
ATCTAAATTTCCGGCCCAAACCTTTTGGAAAATATATTTCGGTTAAAAAT
TCAAAATTCCAGAGCTCAAAAATGGCACTGAGTGTTAATCCCTCCCGAGT
ACTGTTCCGTCCAATTTTTGGTGCGGTTAACAGCTGTGTGCGATTTGCAT
CCGGTTGTGAAAAGAAGGGGCCGAGCCGGTGCCCGAAGGTGTTGACCAAG
TTCCCCTGCGGCAAACCCAATCTGCAGGCTCCGCCCAAGAAGAAGAGGAA
GATGGTCAAGGCACAGTCCATGTGGCTGAACCCATTCTGTGATCCCGACG
ACACCGCCTGTCCGTTCAATCCGCGCTTCGACGATATCTACTACGTCGAG
TCGGACAAGGCCAAGCGGAAGTACTGGCAGACATGGGTGGCCTGCCCTCC
CATCCAGATTAAGCCCAAGAAGATTTGCTGTTTCGCCAAGGCTAAGCCGG
CTCCTATCAAGCGGCGAAAGCCATCGGCGAAGCCATCGACCGCCTGCCCG
CAGCCTTGTCCGGATCCGTCGGAGGATCTGTGTCCCCGTCTGGCCCGTCG
CTGCCATCGCGATGGTCGCCGACCACCCTCATGCAGAAGGGAACGAGGAC
CCCTGCCGTGTGTGAAGCCCCGGACGCCATATCCATCTTTCTCCGAGTGC
CGACGTCTCAAGCCCGATGCCCCGCCACTGAAGGAGTGCAATTGTCTGGC
GAAACCGCTGCTCTGTGAGATTTGGGCCGAGTTCCGACGACGAGCCATTG
CCAAGAAGTAGAGCCGTGGCCCTGATTATATAAAGCGCTTTTACGATTCT
ACAGCAAAAAAAAAAAAAAAAAA

AT20732.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG33340-RA 1144 CG33340-RA 7..862 1..856 4280 100 Plus
nc_18852.a 1014 nc_18852.a 481..1014 544..11 2670 100 Minus
nc_18852.a 1014 nc_18852.a 282..483 856..655 1010 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20186487..20187341 1..855 4260 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:54:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24363153..24364008 1..856 4280 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24103984..24104839 1..856 4280 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:57:53 has no hits.

AT20732.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:58:59 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20186487..20187341 1..855 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:15:38 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
CG33340-RA 1..690 122..811 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:43:58 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
CG33340-RA 1..690 122..811 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:46:52 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
CG33340-RA 1..690 122..811 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:33:07 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
CG33340-RA 1..690 122..811 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:55:29 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
CG33340-RA 1..690 122..811 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:54:24 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
CG33340-RA 7..861 1..855 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:43:58 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
CG33340-RA 16..870 1..855 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:46:52 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
CG33340-RA 16..870 1..855 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:33:07 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
CG33340-RA 7..861 1..855 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:55:29 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
CG33340-RA 16..870 1..855 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:58:59 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24363153..24364007 1..855 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:58:59 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24363153..24364007 1..855 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:58:59 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24363153..24364007 1..855 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:46:52 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20188875..20189729 1..855 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:05:26 Download gff for AT20732.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24103984..24104838 1..855 100   Plus

AT20732.hyp Sequence

Translation from 121 to 810

> AT20732.hyp
MALSVNPSRVLFRPIFGAVNSCVRFASGCEKKGPSRCPKVLTKFPCGKPN
LQAPPKKKRKMVKAQSMWLNPFCDPDDTACPFNPRFDDIYYVESDKAKRK
YWQTWVACPPIQIKPKKICCFAKAKPAPIKRRKPSAKPSTACPQPCPDPS
EDLCPRLARRCHRDGRRPPSCRRERGPLPCVKPRTPYPSFSECRRLKPDA
PPLKECNCLAKPLLCEIWAEFRRRAIAKK*

AT20732.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG33340-PA 229 CG33340-PA 1..229 1..229 1296 100 Plus
CG2127-PB 289 CG2127-PB 64..275 23..224 338 38 Plus
CG2127-PA 305 CG2127-PA 80..291 23..224 338 38 Plus
CG8701-PA 246 CG8701-PA 52..231 46..223 295 41.2 Plus
hubl-PB 291 CG30364-PB 69..268 28..216 244 32.9 Plus

AT20732.pep Sequence

Translation from 121 to 810

> AT20732.pep
MALSVNPSRVLFRPIFGAVNSCVRFASGCEKKGPSRCPKVLTKFPCGKPN
LQAPPKKKRKMVKAQSMWLNPFCDPDDTACPFNPRFDDIYYVESDKAKRK
YWQTWVACPPIQIKPKKICCFAKAKPAPIKRRKPSAKPSTACPQPCPDPS
EDLCPRLARRCHRDGRRPPSCRRERGPLPCVKPRTPYPSFSECRRLKPDA
PPLKECNCLAKPLLCEIWAEFRRRAIAKK*

AT20732.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20746-PA 237 GF20746-PA 1..231 1..228 650 59.9 Plus
Dana\GF12592-PA 303 GF12592-PA 121..289 62..224 258 40.9 Plus
Dana\GF12596-PA 309 GF12596-PA 143..290 85..225 198 38.8 Plus
Dana\GF14894-PA 253 GF14894-PA 101..249 87..225 171 37.8 Plus
Dana\GF12352-PA 229 GF12352-PA 34..216 46..225 170 39.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11285-PA 232 GG11285-PA 1..232 1..229 1061 89.7 Plus
Dere\GG10647-PA 303 GG10647-PA 122..289 62..224 270 42.6 Plus
Dere\GG23352-PA 244 GG23352-PA 52..229 46..223 234 41.5 Plus
Dere\GG10654-PA 291 GG10654-PA 105..268 57..216 186 33.9 Plus
Dere\GG25129-PA 248 GG25129-PA 99..246 86..224 160 38.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18815-PA 169 GH18815-PA 1..166 61..228 546 64.9 Plus
Dgri\GH20816-PA 242 GH20816-PA 89..227 86..224 257 46.4 Plus
Dgri\GH19654-PA 242 GH19654-PA 89..227 86..224 257 46.4 Plus
Dgri\GH20817-PA 240 GH20817-PA 17..226 12..224 234 35.9 Plus
Dgri\GH20820-PA 223 GH20820-PA 27..215 45..226 165 32.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG33340-PA 229 CG33340-PA 1..229 1..229 1296 100 Plus
CG2127-PB 289 CG2127-PB 64..275 23..224 338 38 Plus
CG2127-PA 305 CG2127-PA 80..291 23..224 338 38 Plus
CG8701-PA 246 CG8701-PA 52..231 46..223 295 41.2 Plus
hubl-PB 291 CG30364-PB 69..268 28..216 244 32.9 Plus
hubl-PA 291 CG30364-PA 69..268 28..216 244 32.9 Plus
CG4691-PA 262 CG4691-PA 114..260 87..224 222 39.6 Plus
boly-PA 255 CG30362-PA 95..253 73..224 206 33.9 Plus
swif-PB 284 CG30366-PB 90..279 43..224 204 32.8 Plus
swif-PA 284 CG30366-PA 90..279 43..224 204 32.8 Plus
cola-PA 259 CG30363-PA 96..228 85..218 201 37.5 Plus
CG12861-PA 239 CG12861-PA 77..237 76..224 199 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10075-PA 236 GI10075-PA 47..233 45..228 559 63.3 Plus
Dmoj\GI20912-PA 250 GI20912-PA 25..237 19..225 290 40.5 Plus
Dmoj\GI20909-PA 248 GI20909-PA 80..233 73..224 278 50 Plus
Dmoj\GI18687-PA 297 GI18687-PA 98..289 58..229 178 35.4 Plus
Dmoj\GI20916-PA 257 GI20916-PA 97..237 85..229 162 35.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21858-PA 176 GL21858-PA 15..176 66..229 493 67.3 Plus
Dper\GL11217-PA 243 GL11217-PA 90..227 84..223 264 49.3 Plus
Dper\GL10866-PA 259 GL10866-PA 52..250 46..229 224 34.8 Plus
Dper\GL10869-PA 261 GL10869-PA 97..259 73..224 146 34.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26429-PA 176 GA26429-PA 15..176 66..229 497 68.5 Plus
Dpse\GA21267-PA 243 GA21267-PA 90..227 84..223 264 49.3 Plus
Dpse\GA15259-PA 259 GA15259-PA 52..250 46..229 228 35.3 Plus
Dpse\GA15789-PA 261 GA15789-PA 97..259 73..224 145 37.5 Plus
Dpse\GA11864-PA 216 GA11864-PA 51..212 76..224 142 35.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26593-PA 232 GM26593-PA 1..232 1..229 1107 95.7 Plus
Dsec\GM20692-PA 305 GM20692-PA 122..291 62..224 253 40.4 Plus
Dsec\GM20699-PA 291 GM20699-PA 105..268 57..216 175 34.5 Plus
Dsec\GM20695-PA 252 GM20695-PA 108..248 87..222 164 34.2 Plus
Dsec\GM20696-PA 259 GM20696-PA 96..233 85..223 150 36.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21095-PA 232 GD21095-PA 1..232 1..229 1103 95.3 Plus
Dsim\GD15275-PA 305 GD15275-PA 122..291 62..224 260 40.9 Plus
Dsim\GD15282-PA 291 GD15282-PA 105..268 57..216 175 34.5 Plus
Dsim\GD15283-PA 291 GD15283-PA 105..268 57..216 175 34.5 Plus
Dsim\GD15278-PA 252 GD15278-PA 108..248 87..222 167 35.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23810-PA 238 GJ23810-PA 19..235 16..228 623 60.6 Plus
Dvir\GJ20639-PA 249 GJ20639-PA 84..237 73..227 277 46.5 Plus
Dvir\GJ20641-PA 249 GJ20641-PA 38..235 29..224 269 39.5 Plus
Dvir\GJ20648-PA 301 GJ20648-PA 119..291 65..229 198 37.1 Plus
Dvir\GJ20646-PA 263 GJ20646-PA 102..244 85..229 174 35.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19110-PA 237 GK19110-PA 13..235 7..229 642 59.7 Plus
Dwil\GK15752-PA 216 GK15752-PA 64..201 84..223 284 50.7 Plus
Dwil\GK15825-PA 289 GK15825-PA 112..275 66..224 238 41.6 Plus
Dwil\GK19093-PA 213 GK19093-PA 38..209 65..227 186 36 Plus
Dwil\GK15759-PA 265 GK15759-PA 101..240 85..223 186 36.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23478-PA 232 GE23478-PA 1..232 1..229 1056 90.5 Plus
Dyak\GE23064-PA 307 GE23064-PA 124..293 62..224 271 42.1 Plus
Dyak\GE19192-PA 245 GE19192-PA 91..231 84..223 236 46.2 Plus
Dyak\GE23134-PA 291 GE23134-PA 83..268 41..216 180 32.6 Plus
Dyak\GE23113-PA 284 GE23113-PA 110..279 65..224 160 37.2 Plus