Clone AT20876 Report

Search the DGRC for AT20876

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:208
Well:76
Vector:pOTB7
Associated Gene/TranscriptCG7059-RA
Protein status:AT20876.pep: gold
Preliminary Size:1066
Sequenced Size:1237

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7059 2002-01-01 Sim4 clustering to Release 2
CG7059 2002-01-03 Blastp of sequenced clone
CG7059 2003-01-01 Sim4 clustering to Release 3
CG7059 2008-04-29 Release 5.5 accounting
CG7059 2008-08-15 Release 5.9 accounting
CG7059 2008-12-18 5.12 accounting

Clone Sequence Records

AT20876.complete Sequence

1237 bp (1237 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075244

> AT20876.complete
CAAAAACCAACTGCGCCGCGATAAAATTGTTTGCCAATAAGAATCGGGCT
TAGTGCGGATTGGCATCCGAAAGATACAGGAACGTGGTGGCTGCAGCTGC
AACGGGAAGACCATGGTTTTCTTCAAGTTCTTGAAGAGCAAACTCTCCCA
ATTTATGACGAAAACAAATCGCTTGGTGATTTTGAGGCATGGCGAAAGTG
ATTTCAACATTGAGAACAAATTCTGCGGTTGGCATGATGCGCCATTGAGT
GAATTCGGCGTCCAAGAGGCGCTGACTGTGGCGATTCCCGCGCTCGTCCA
ATCCGAGTTGGAATTCGACGTGGTCTATTCATCCGTATTGAGCAGATCTC
GTCAAACGGCCGAATTGATACTCTCCAAGTTGAACTGCGCCTATGTGCCC
ATTAAGGAGGATTGGCGGCTGTGCGAAAGGCACTACGGAAATCTGACTGG
TTGCCGGAAACGAGTGGTAGCCGATCGCTATGGGGAGGAGCAGGTTCAGG
CCTGGCGACGTGGATACGACTGCGTACCGCCGCCCATCGATGAGAAGAAC
CGCTACTTCTACACCATTTGCAGCAATCCCATATTCGATGATGTTCCTCG
CGGTGAGTTCCCCCTCGCGGAATCCCTTCACATGTGCGTCGATCGAGTGA
AACCCGTGTGGAAGGAGGTCAGGCGGGAAGTGTTCCAAGGCACCCGGGTA
CTAATGTGCGTCCACGGAACTGTGGCCCGTGCTCTCGTCCAGCACATTGA
GGGAATCTCCAACGAGGCCATCGAAAAGGTTAACATTCCAAATTGCGTGC
CACGCGTCTATGAGTTCGATTTGAAAACGGGAGGCTTGGTTGGAGCTGCC
ATCAATCTGGGGGATCAGGAGTATATTAGGCGGAAGACAGCCCAGGTGGC
AGCCATTGGTGACTGATTGTGGAGCACTCCTCTCGACTTTTTTGGAATTT
ACATCGATATGTGGCCGACTGCATTTACTTAAGCCTTTGCCGCTTAAAGT
CCGAGAACATCGGCTGATAAGGATATTATGACTACTATTTATTGGTCTAC
ACCATCTGATATTTTCGGCCAAAAATATACAATTTATACAAAATATAATT
GATGGAGAAGATTACATATACGTACATAAATATAATAAAAATAAGCTATT
TCGTTGTATGACGTCAAATTGGATGCTACACCCAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT20876.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG7059-RA 1498 CG7059-RA 304..1498 1..1195 5930 99.7 Plus
CG7059.d 1582 CG7059.d 532..1582 145..1195 5210 99.7 Plus
CG7059.e 1653 CG7059.e 603..1653 145..1195 5210 99.7 Plus
CG7059.d 1582 CG7059.d 259..402 1..144 720 100 Plus
CG7059.e 1653 CG7059.e 330..473 1..144 720 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18214900..18215396 257..753 2485 100 Plus
chr3R 27901430 chr3R 18215451..18215882 752..1183 2160 100 Plus
chr3R 27901430 chr3R 18213472..18213615 1..144 720 100 Plus
chr3R 27901430 chr3R 18214725..18214838 145..258 570 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:55:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22391368..22391864 257..753 2455 99.6 Plus
3R 32079331 3R 22391919..22392362 752..1195 2205 99.8 Plus
3R 32079331 3R 22389930..22390073 1..144 720 100 Plus
3R 32079331 3R 22391194..22391307 145..258 570 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22132199..22132695 257..753 2455 99.5 Plus
3R 31820162 3R 22132750..22133193 752..1195 2205 99.7 Plus
3R 31820162 3R 22130761..22130904 1..144 720 100 Plus
3R 31820162 3R 22132025..22132138 145..258 570 100 Plus
Blast to na_te.dros performed 2019-03-16 00:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1097..1171 1144..1071 111 66.2 Minus

AT20876.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:53:17 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18214725..18214837 145..257 100 -> Plus
chr3R 18213479..18213615 8..144 100 -> Plus
chr3R 18214901..18215395 258..752 100 -> Plus
chr3R 18215452..18215882 753..1183 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:15:50 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RA 1..804 113..916 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:57:28 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RA 1..804 113..916 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:59:15 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RA 1..804 113..916 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:22:13 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RA 1..804 113..916 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:16:34 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RA 1..804 113..916 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:22:03 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RA 151..1332 1..1183 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:57:28 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RA 151..1332 1..1183 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:59:15 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RA 151..1332 1..1182 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:22:13 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RA 151..1332 1..1183 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:16:34 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RA 151..1332 1..1182 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:53:17 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22389930..22390073 1..144 100 -> Plus
3R 22391194..22391306 145..257 100 -> Plus
3R 22391369..22391863 258..752 99 -> Plus
3R 22391920..22392349 753..1183 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:53:17 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22389930..22390073 1..144 100 -> Plus
3R 22391194..22391306 145..257 100 -> Plus
3R 22391369..22391863 258..752 99 -> Plus
3R 22391920..22392349 753..1183 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:53:17 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22389930..22390073 1..144 100 -> Plus
3R 22391194..22391306 145..257 100 -> Plus
3R 22391369..22391863 258..752 99 -> Plus
3R 22391920..22392349 753..1183 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:59:15 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18215652..18215795 1..144 100 -> Plus
arm_3R 18216916..18217028 145..257 100 -> Plus
arm_3R 18217091..18217585 258..752 99 -> Plus
arm_3R 18217642..18218071 753..1183 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:57:09 Download gff for AT20876.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22132200..22132694 258..752 99 -> Plus
3R 22132751..22133180 753..1183 99   Plus
3R 22130761..22130904 1..144 100 -> Plus
3R 22132025..22132137 145..257 100 -> Plus

AT20876.pep Sequence

Translation from 112 to 915

> AT20876.pep
MVFFKFLKSKLSQFMTKTNRLVILRHGESDFNIENKFCGWHDAPLSEFGV
QEALTVAIPALVQSELEFDVVYSSVLSRSRQTAELILSKLNCAYVPIKED
WRLCERHYGNLTGCRKRVVADRYGEEQVQAWRRGYDCVPPPIDEKNRYFY
TICSNPIFDDVPRGEFPLAESLHMCVDRVKPVWKEVRREVFQGTRVLMCV
HGTVARALVQHIEGISNEAIEKVNIPNCVPRVYEFDLKTGGLVGAAINLG
DQEYIRRKTAQVAAIGD*

AT20876.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18444-PA 265 GF18444-PA 1..264 3..266 1111 74.2 Plus
Dana\GF23292-PA 255 GF23292-PA 1..252 15..266 500 41.7 Plus
Dana\GF17736-PA 288 GF17736-PA 39..285 20..266 496 38.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11129-PA 267 GG11129-PA 1..267 1..267 1396 96.6 Plus
Dere\GG17149-PA 292 GG17149-PA 43..289 20..266 505 41.4 Plus
Dere\GG11648-PA 255 GG11648-PA 1..252 15..266 501 41.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13344-PA 265 GH13344-PA 1..265 3..267 930 62.3 Plus
Dgri\GH15422-PA 247 GH15422-PA 1..244 23..266 505 39 Plus
Dgri\GH23221-PA 255 GH23221-PA 1..252 15..266 493 40.9 Plus
Dgri\GH14297-PA 255 GH14297-PA 1..252 15..266 493 40.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG7059-PA 267 CG7059-PA 1..267 1..267 1414 100 Plus
CG7059-PD 262 CG7059-PD 7..262 12..267 1360 100 Plus
CG7059-PC 253 CG7059-PC 1..253 15..267 1345 100 Plus
Pglym78-PC 255 CG1721-PC 6..252 20..266 501 41.4 Plus
Pglym78-PB 255 CG1721-PB 6..252 20..266 501 41.4 Plus
Pglym78-PA 255 CG1721-PA 6..252 20..266 501 41.4 Plus
Pglym87-PA 292 CG17645-PA 43..289 20..266 486 41 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22381-PA 268 GI22381-PA 6..268 5..267 876 59.3 Plus
Dmoj\GI10280-PA 293 GI10280-PA 45..290 21..266 521 39.1 Plus
Dmoj\GI23192-PA 255 GI23192-PA 1..252 15..266 500 41.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24208-PA 267 GL24208-PA 1..267 1..267 1091 73.4 Plus
Dper\GL23914-PA 255 GL23914-PA 1..252 15..266 526 41.3 Plus
Dper\GL21564-PA 309 GL21564-PA 60..306 20..266 526 41.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20068-PA 267 GA20068-PA 1..267 1..267 1091 73.4 Plus
Dpse\GA20068-PB 252 GA20068-PB 2..252 17..267 1040 74.1 Plus
Dpse\GA14593-PA 290 GA14593-PA 41..287 20..266 534 42.6 Plus
Dpse\GA14392-PA 255 GA14392-PA 1..252 15..266 526 41.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26427-PA 267 GM26427-PA 1..267 1..267 1424 98.9 Plus
Dsec\GM26030-PA 292 GM26030-PA 43..289 20..266 503 41.4 Plus
Dsec\GM12771-PA 255 GM12771-PA 1..252 15..266 498 41.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20944-PA 267 GD20944-PA 1..267 1..267 1424 98.9 Plus
Dsim\GD20588-PA 341 GD20588-PA 43..286 20..263 497 41.5 Plus
Dsim\GD21420-PA 429 GD21420-PA 6..112 20..127 280 50 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24414-PA 265 GJ24414-PA 1..265 3..267 911 61.1 Plus
Dvir\GJ11087-PA 299 GJ11087-PA 51..296 21..266 507 40.7 Plus
Dvir\GJ14508-PA 255 GJ14508-PA 1..252 15..266 498 41.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14265-PA 267 GK14265-PA 1..266 1..266 1043 67.7 Plus
Dwil\GK11893-PA 255 GK11893-PA 1..252 15..266 530 41.7 Plus
Dwil\GK11561-PA 287 GK11561-PA 37..284 20..266 500 40.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10295-PA 253 GE10295-PA 1..253 15..267 1308 95.7 Plus
Dyak\GE24538-PA 292 GE24538-PA 43..289 20..266 502 41.4 Plus
Dyak\Pglym78-PA 255 GE23839-PA 1..252 15..266 492 41.3 Plus

AT20876.hyp Sequence

Translation from 112 to 915

> AT20876.hyp
MVFFKFLKSKLSQFMTKTNRLVILRHGESDFNIENKFCGWHDAPLSEFGV
QEALTVAIPALVQSELEFDVVYSSVLSRSRQTAELILSKLNCAYVPIKED
WRLCERHYGNLTGCRKRVVADRYGEEQVQAWRRGYDCVPPPIDEKNRYFY
TICSNPIFDDVPRGEFPLAESLHMCVDRVKPVWKEVRREVFQGTRVLMCV
HGTVARALVQHIEGISNEAIEKVNIPNCVPRVYEFDLKTGGLVGAAINLG
DQEYIRRKTAQVAAIGD*

AT20876.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG7059-PA 267 CG7059-PA 1..267 1..267 1414 100 Plus
CG7059-PD 262 CG7059-PD 7..262 12..267 1360 100 Plus
CG7059-PC 253 CG7059-PC 1..253 15..267 1345 100 Plus
Pglym78-PC 255 CG1721-PC 6..252 20..266 501 41.4 Plus
Pglym78-PB 255 CG1721-PB 6..252 20..266 501 41.4 Plus