Clone AT21115 Report

Search the DGRC for AT21115

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:211
Well:15
Vector:pOTB7
Associated Gene/TranscriptGstD9-RA
Protein status:AT21115.pep: gold
Sequenced Size:770

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
GstD9-RA 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

AT21115.complete Sequence

770 bp assembled on 2010-12-02

GenBank Submission: BT125804.1

> AT21115.complete
CTCAGCGAGTAATCATGTTGGACTTCTACTATATGCTCTACTCGGCACCT
TGCCGTTCCATCCTGATGACGGCCCGTGCCCTGGGATTGGAGCTGAACAA
GAAGCAGGTGGATCTGGATGCCGGCGAGCATCTTAAGCCGGAATTTGTAA
AGATCAATCCTCAGCATACGATTCCCACGCTGGTTGACGATGGTTTCGCC
ATCTGGGAGTCGAGGGCTATACTGATTTATCTGGCCGAGAAGTACGATAA
AGATGGCTCCCTTTATCCCAAGGATCCCCAGCAGAGAGCCGTGATCAATC
AGCGCCTGTTTTTCGATCTGAGTACTCTGTACCAGAGCTACGTGTACTAC
TACTATCCCCAGTTGTTCGAGGATGTGAAGAAGCCAGCTGATCCCGATAA
CCTCAAGAAGATCGATGATGCTTTCGCTATGTTCAATACTCTGTTGAAGG
GTCAGCAGTACGCCGCCCTCAACAAGTTGACTCTGGCCGATTTTGCGCTT
CTGGCCACCGTTTCCACTTTTGAAATATCGGAATATGATTTTGGTAAATA
TCCGGAAGTGGTTAGGTGGTACGACAATGCCAAGAAAGTGATACCCGGCT
GGGAGGAGAACTGGGAGGGCTGCGAGTACTACAAGAAATTGTATCTGGGT
GCGATTTTGAACAAACAATGACGGGTCTGTAATAAATAATCTAATCTGTA
TCGACCTGTTTGAATAAAGAGTGAGACATTGTGAAATGACAATGAGTATA
ACAAAAAAAAAAAAAAAAAA

AT21115.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8191537..8192288 752..1 3760 100 Minus
chr3R 27901430 chr3R 8193594..8193942 369..21 425 74.8 Minus
chr3R 27901430 chr3R 8197492..8197717 135..360 350 77 Plus
chr3R 27901430 chr3R 8199656..8199838 135..317 300 77.6 Plus
chr3R 27901430 chr3R 8198601..8198758 150..307 265 77.8 Plus
chr3R 27901430 chr3R 8197915..8197971 564..620 195 89.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12366157..12366911 755..1 3760 99.9 Minus
3R 32079331 3R 12368217..12368565 369..21 425 74.8 Minus
3R 32079331 3R 12372115..12372340 135..360 350 77 Plus
3R 32079331 3R 12374270..12374452 135..317 300 77.6 Plus
3R 32079331 3R 12373214..12373371 150..307 265 77.8 Plus
3R 32079331 3R 12372538..12372594 564..620 195 89.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12106988..12107742 755..1 3760 99.8 Minus
3R 31820162 3R 12109171..12109396 246..21 275 74.7 Minus
3R 31820162 3R 12114045..12114202 150..307 265 77.8 Plus
3R 31820162 3R 12112946..12113022 135..211 220 85.7 Plus
3R 31820162 3R 12115101..12115177 135..211 205 84.4 Plus
3R 31820162 3R 12109048..12109160 369..257 205 78.7 Minus
3R 31820162 3R 12113369..12113425 564..620 195 89.4 Plus
3R 31820162 3R 12113039..12113171 228..360 185 75.9 Plus
3R 31820162 3R 12116712..12116788 135..211 175 81.8 Plus
3R 31820162 3R 12121407..12121459 564..616 175 88.6 Plus
3R 31820162 3R 12108808..12108859 615..564 170 88.4 Minus
3R 31820162 3R 12119503..12119580 135..212 165 80.7 Plus
3R 31820162 3R 12105782..12105830 615..567 155 87.7 Minus
3R 31820162 3R 12115194..12115283 228..317 150 77.7 Plus
3R 31820162 3R 12118222..12118317 237..332 150 77 Plus
Blast to na_te.dros performed on 2019-03-17 01:13:46 has no hits.

AT21115.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:14:41 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8191537..8192288 1..752 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-12-03 14:29:01 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
GstD9-RA 1..657 15..671 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:44:40 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
GstD9-RA 1..657 15..671 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:32:58 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
GstD9-RA 1..657 15..671 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:52:30 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
GstD9-RA 1..657 15..671 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-12-03 14:29:01 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
GstD9-RA 27..758 1..732 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:44:40 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
GstD9-RA 27..758 1..732 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:32:58 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
GstD9-RA 27..758 1..732 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:52:30 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
GstD9-RA 27..775 1..749 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:14:41 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12366160..12366911 1..752 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:14:41 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12366160..12366911 1..752 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:14:41 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12366160..12366911 1..752 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:32:58 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8191882..8192633 1..752 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:51:54 Download gff for AT21115.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12106991..12107742 1..752 99   Minus

AT21115.pep Sequence

Translation from 2 to 670

> AT21115.pep
QRVIMLDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVK
INPQHTIPTLVDDGFAIWESRAILIYLAEKYDKDGSLYPKDPQQRAVINQ
RLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKIDDAFAMFNTLLKG
QQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKVIPGW
EENWEGCEYYKKLYLGAILNKQ*

AT21115.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17053-PA 225 GF17053-PA 1..218 5..222 940 85.8 Plus
Dana\GF17052-PA 209 GF17052-PA 1..208 5..214 757 64.8 Plus
Dana\GF17947-PA 214 GF17947-PA 1..200 6..207 681 60.4 Plus
Dana\GF17054-PA 210 GF17054-PA 1..208 6..214 675 58.1 Plus
Dana\GF17943-PA 218 GF17943-PA 1..206 6..212 654 57.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17137-PA 218 GG17137-PA 1..218 5..222 1050 95 Plus
Dere\GstD1-PA 209 GG17135-PA 1..208 5..214 751 64.3 Plus
Dere\GG18761-PA 215 GG18761-PA 1..207 6..214 714 64.1 Plus
Dere\GG18806-PA 212 GG18806-PA 1..206 6..213 696 59.6 Plus
Dere\GG17138-PA 210 GG17138-PA 1..208 6..214 689 59 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20186-PA 209 GH20186-PA 1..208 5..214 756 65.2 Plus
Dgri\GH13103-PA 209 GH13103-PA 1..208 5..214 753 64.8 Plus
Dgri\GH20548-PA 213 GH20548-PA 1..199 6..206 693 61.7 Plus
Dgri\GH17520-PA 213 GH17520-PA 1..199 6..206 693 61.7 Plus
Dgri\GH17521-PA 216 GH17521-PA 1..205 6..212 678 58.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
GstD9-PB 218 CG10091-PB 1..218 5..222 1160 100 Plus
GstD9-PA 218 CG10091-PA 1..218 5..222 1160 100 Plus
GstD1-PB 209 CG10045-PB 1..208 5..214 761 65.7 Plus
GstD1-PA 209 CG10045-PA 1..208 5..214 761 65.7 Plus
GstD8-PA 212 CG4421-PA 1..206 6..213 698 61.1 Plus
GstD2-PA 215 CG4181-PA 1..207 6..214 695 61.7 Plus
GstD10-PB 210 CG18548-PB 1..208 6..214 676 58.6 Plus
GstD10-PA 210 CG18548-PA 1..208 6..214 676 58.6 Plus
GstD4-PA 215 CG11512-PA 1..207 6..214 672 58.4 Plus
GstD5-PA 216 CG12242-PA 1..207 6..214 642 56 Plus
GstD6-PA 215 CG4423-PA 1..214 6..221 579 51.4 Plus
GstD7-PA 224 CG4371-PA 4..209 6..212 556 53.4 Plus
GstD3-PA 199 CG4381-PA 1..189 22..212 554 52.9 Plus
GstD11-PA 222 CG17639-PA 7..190 9..194 425 44.1 Plus
GstD11-PB 243 CG17639-PB 28..211 9..194 425 44.1 Plus
GstE10-PB 240 CG17522-PB 12..202 14..203 362 39.6 Plus
GstE10-PA 240 CG17522-PA 12..202 14..203 362 39.6 Plus
GstE7-PA 223 CG17531-PA 4..200 6..202 344 37.9 Plus
GstE2-PA 221 CG17523-PA 5..218 6..220 343 38 Plus
GstE1-PA 224 CG5164-PA 14..201 15..202 343 40.5 Plus
GstE3-PA 220 CG17524-PA 4..199 6..202 337 39.4 Plus
GstE6-PA 222 CG17530-PA 1..200 3..202 337 36.3 Plus
GstE12-PC 223 CG16936-PC 7..213 9..214 335 37.5 Plus
GstE12-PB 223 CG16936-PB 7..213 9..214 335 37.5 Plus
GstE12-PD 223 CG16936-PD 7..213 9..214 335 37.5 Plus
GstE12-PA 223 CG16936-PA 7..213 9..214 335 37.5 Plus
GstE11-PB 225 CG5224-PB 8..223 9..222 331 35 Plus
GstE11-PA 225 CG5224-PA 8..223 9..222 331 35 Plus
gfzf-PE 1045 CG33546-PE 809..1008 3..201 324 37.6 Plus
gfzf-PB 1045 CG33546-PB 809..1008 3..201 324 37.6 Plus
gfzf-PD 234 CG33546-PD 1..197 6..201 323 38.2 Plus
GstE5-PA 222 CG17527-PA 1..200 3..202 313 34.8 Plus
GstE8-PB 222 CG17533-PB 12..200 14..202 295 34.2 Plus
GstE8-PA 222 CG17533-PA 12..200 14..202 295 34.2 Plus
GstE9-PA 221 CG17534-PA 4..190 6..191 289 35.8 Plus
GstE4-PA 222 CG17525-PA 4..212 6..213 288 34.4 Plus
GstE13-PB 226 CG11784-PB 7..201 9..202 278 32.7 Plus
GstE13-PA 226 CG11784-PA 7..201 9..202 278 32.7 Plus
GstE14-PA 232 CG4688-PA 9..206 9..208 273 30.5 Plus
GstT3-PC 228 CG1702-PC 7..203 8..195 157 26.4 Plus
GstT3-PA 228 CG1702-PA 7..203 8..195 157 26.4 Plus
GstT3-PB 268 CG1702-PB 47..243 8..195 157 26.4 Plus
GstT1-PA 228 CG30000-PA 5..202 6..194 148 23.2 Plus
GstT2-PA 228 CG30005-PA 7..202 8..194 146 24.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22354-PA 208 GI22354-PA 1..207 6..214 748 64.6 Plus
Dmoj\GI24379-PA 209 GI24379-PA 1..208 5..214 748 63.3 Plus
Dmoj\GI23193-PA 214 GI23193-PA 1..201 6..208 676 59.6 Plus
Dmoj\GI23194-PA 213 GI23194-PA 1..209 6..216 667 58.3 Plus
Dmoj\GI23195-PA 216 GI23195-PA 1..207 6..214 646 56.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27185-PA 216 GL27185-PA 1..216 6..221 935 85.6 Plus
Dper\GL27184-PA 209 GL27184-PA 1..208 5..214 768 66.2 Plus
Dper\GL27300-PA 217 GL27300-PA 1..206 6..213 712 62 Plus
Dper\GL27303-PA 213 GL27303-PA 1..207 6..213 660 57.4 Plus
Dper\GL27186-PA 209 GL27186-PA 1..207 6..214 642 56.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10065-PA 216 GA10065-PA 1..216 6..221 940 85.6 Plus
Dpse\GA10031-PA 209 GA10031-PA 1..208 5..214 768 66.2 Plus
Dpse\GA18009-PA 219 GA18009-PA 1..206 6..213 705 61.1 Plus
Dpse\GA18171-PA 213 GA18171-PA 1..207 6..213 657 57.4 Plus
Dpse\GA14986-PA 209 GA14986-PA 1..207 6..214 635 55.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26021-PA 218 GM26021-PA 1..218 5..222 1146 99.1 Plus
Dsec\GstD1-PA 209 GM26019-PA 1..208 5..214 761 64.8 Plus
Dsec\GM24021-PA 212 GM24021-PA 1..206 6..213 708 61.1 Plus
Dsec\GM26022-PA 210 GM26022-PA 1..208 6..214 664 56.7 Plus
Dsec\GM24018-PA 215 GM24018-PA 1..207 6..214 664 57.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20578-PA 218 GD20578-PA 1..218 5..222 1131 97.2 Plus
Dsim\GstD1-PA 209 GD20577-PA 1..208 5..214 759 64.8 Plus
Dsim\GD18821-PA 212 GD18821-PA 1..206 6..213 711 61.5 Plus
Dsim\GD18815-PA 215 GD18815-PA 1..207 6..214 698 60.8 Plus
Dsim\GD18817-PA 215 GD18817-PA 1..207 6..214 679 58.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24386-PA 214 GJ24386-PA 1..214 5..218 853 77.6 Plus
Dvir\GJ24385-PA 209 GJ24385-PA 1..208 5..214 754 64.8 Plus
Dvir\GJ22854-PA 213 GJ22854-PA 1..205 6..212 666 59.4 Plus
Dvir\GJ22852-PA 214 GJ22852-PA 1..196 6..203 663 59.6 Plus
Dvir\GJ14446-PA 213 GJ14446-PA 1..206 6..213 649 56.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11205-PA 217 GK11205-PA 1..216 5..220 907 83.3 Plus
Dwil\GK11204-PA 209 GK11204-PA 1..208 5..214 775 66.2 Plus
Dwil\GK11874-PA 219 GK11874-PA 1..206 6..213 718 63.5 Plus
Dwil\GK11202-PA 218 GK11202-PA 4..209 6..213 699 62 Plus
Dwil\GK11873-PA 216 GK11873-PA 1..206 6..213 673 59.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:49:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24528-PA 218 GE24528-PA 1..218 5..222 1052 94.5 Plus
Dyak\GstD1-PA 209 GE24527-PA 1..208 5..214 753 64.8 Plus
Dyak\GE26175-PA 215 GE26175-PA 1..207 6..214 714 62.7 Plus
Dyak\GE26181-PA 212 GE26181-PA 1..206 6..213 707 60.1 Plus
Dyak\GE26177-PA 215 GE26177-PA 1..207 6..214 677 58.9 Plus

AT21115.hyp Sequence

Translation from 2 to 670

> AT21115.hyp
QRVIMLDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVK
INPQHTIPTLVDDGFAIWESRAILIYLAEKYDKDGSLYPKDPQQRAVINQ
RLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLKKIDDAFAMFNTLLKG
QQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKVIPGW
EENWEGCEYYKKLYLGAILNKQ*

AT21115.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
GstD9-PB 218 CG10091-PB 1..218 5..222 1160 100 Plus
GstD9-PA 218 CG10091-PA 1..218 5..222 1160 100 Plus
GstD1-PB 209 CG10045-PB 1..208 5..214 761 65.7 Plus
GstD1-PA 209 CG10045-PA 1..208 5..214 761 65.7 Plus
GstD8-PA 212 CG4421-PA 1..206 6..213 698 61.1 Plus