Clone AT21341 Report

Search the DGRC for AT21341

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:213
Well:41
Vector:pOTB7
Associated Gene/TranscriptCG32148-RA
Protein status:AT21341.pep: gold
Sequenced Size:477

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32148 2001-12-16 Blastp of sequenced clone
CG13463 2002-01-01 Sim4 clustering to Release 2
CG32148 2003-01-01 Sim4 clustering to Release 3
CG32148 2008-04-29 Release 5.5 accounting
CG32148 2008-08-15 Release 5.9 accounting
CG32148 2008-12-18 5.12 accounting

Clone Sequence Records

AT21341.complete Sequence

477 bp (477 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070809

> AT21341.complete
TCTCATTCGACATCATTTTTCGTTCCTAGCTGTTCAAAATTATTCCATTT
ACTCAGTTAATTTCTTTCACCAAAATGAGTGGAATTCTGTTAAAATTTCT
GCCCAAAAACGAGTTGCTTCATCAATCACTATACTTTTGCAGAGGAATGG
CCAAAAAGAAGAGCCAAAGTCAAGGCACCGAAAAGGGCAAGAAAACCTGT
AATAAGAATCAGTTCTTTGGCGGCTGCTTTAAGAAGTCCGAACCATTTAG
GAGGGAGAACAAGAAGGAGAAGAGCAAACGATGTCGGGATCCTTGCAAAG
ATGGACCCTGTCGCCCCGAGAAATAGGATGAATTCGTAAAAACTGCAATT
ATAACTAACGTCACTCTATCCTCGTTTAGTTTCCATTTCCATTGAAAGTT
CCCTATAGACAATGGCTGACTTGAATAGAATATACCAATACTGGTTTTAA
ATTTAAAAAAAAAAAAAAAAAAAAAAA

AT21341.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG32148-RA 647 CG32148-RA 77..534 1..456 2145 98.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15013573..15013806 1..234 1170 100 Plus
chr3L 24539361 chr3L 15013869..15014088 235..454 1025 97.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:55:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15023492..15023725 1..234 1170 100 Plus
3L 28110227 3L 15023788..15024011 235..456 965 96.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15016592..15016825 1..234 1170 100 Plus
3L 28103327 3L 15016888..15017111 235..456 975 96.4 Plus
Blast to na_te.dros performed on 2019-03-15 17:54:11 has no hits.

AT21341.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:55:11 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15013573..15013806 1..234 100 -> Plus
chr3L 15013869..15014088 235..454 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:16:16 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
CG32148-RA 1..252 75..326 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:40 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
CG32148-RA 1..252 75..326 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:50:01 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
CG32148-RA 1..252 75..326 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:13 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
CG32148-RA 1..252 75..326 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:50:00 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
CG32148-RA 1..252 75..326 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:06 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
CG32148-RA 1..456 1..454 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:40 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
CG32148-RA 1..456 1..454 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:50:01 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
CG32148-RA 1..456 1..454 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:14 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
CG32148-RA 1..456 1..454 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:50:00 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
CG32148-RA 1..456 1..454 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:55:11 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15023492..15023725 1..234 100 -> Plus
3L 15023788..15024009 235..454 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:55:11 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15023492..15023725 1..234 100 -> Plus
3L 15023788..15024009 235..454 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:55:11 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15023492..15023725 1..234 100 -> Plus
3L 15023788..15024009 235..454 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:50:01 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15016592..15016825 1..234 100 -> Plus
arm_3L 15016888..15017109 235..454 96   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:01:55 Download gff for AT21341.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15016592..15016825 1..234 100 -> Plus
3L 15016888..15017109 235..454 96   Plus

AT21341.hyp Sequence

Translation from 74 to 325

> AT21341.hyp
MSGILLKFLPKNELLHQSLYFCRGMAKKKSQSQGTEKGKKTCNKNQFFGG
CFKKSEPFRRENKKEKSKRCRDPCKDGPCRPEK*

AT21341.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:09:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG32148-PA 83 CG32148-PA 1..83 1..83 459 100 Plus

AT21341.pep Sequence

Translation from 74 to 325

> AT21341.pep
MSGILLKFLPKNELLHQSLYFCRGMAKKKSQSQGTEKGKKTCNKNQFFGG
CFKKSEPFRRENKKEKSKRCRDPCKDGPCRPEK*

AT21341.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23680-PA 59 GF23680-PA 1..59 25..83 216 72.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15713-PA 83 GG15713-PA 1..83 1..83 359 85.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG32148-PA 83 CG32148-PA 1..83 1..83 459 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25500-PA 83 GM25500-PA 1..83 1..83 404 94 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14519-PA 83 GD14519-PA 1..83 1..83 396 94 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16788-PA 123 GK16788-PA 17..74 23..78 138 58.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22044-PA 83 GE22044-PA 1..83 1..83 386 91.6 Plus