AT21341.complete Sequence
477 bp (477 high quality bases) assembled on 2001-12-16
GenBank Submission: AY070809
> AT21341.complete
TCTCATTCGACATCATTTTTCGTTCCTAGCTGTTCAAAATTATTCCATTT
ACTCAGTTAATTTCTTTCACCAAAATGAGTGGAATTCTGTTAAAATTTCT
GCCCAAAAACGAGTTGCTTCATCAATCACTATACTTTTGCAGAGGAATGG
CCAAAAAGAAGAGCCAAAGTCAAGGCACCGAAAAGGGCAAGAAAACCTGT
AATAAGAATCAGTTCTTTGGCGGCTGCTTTAAGAAGTCCGAACCATTTAG
GAGGGAGAACAAGAAGGAGAAGAGCAAACGATGTCGGGATCCTTGCAAAG
ATGGACCCTGTCGCCCCGAGAAATAGGATGAATTCGTAAAAACTGCAATT
ATAACTAACGTCACTCTATCCTCGTTTAGTTTCCATTTCCATTGAAAGTT
CCCTATAGACAATGGCTGACTTGAATAGAATATACCAATACTGGTTTTAA
ATTTAAAAAAAAAAAAAAAAAAAAAAA
AT21341.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:38:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32148-RA | 647 | CG32148-RA | 77..534 | 1..456 | 2145 | 98.2 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:54:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 15013573..15013806 | 1..234 | 1170 | 100 | Plus |
chr3L | 24539361 | chr3L | 15013869..15014088 | 235..454 | 1025 | 97.7 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:55:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:54:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15023492..15023725 | 1..234 | 1170 | 100 | Plus |
3L | 28110227 | 3L | 15023788..15024011 | 235..456 | 965 | 96.4 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 15016592..15016825 | 1..234 | 1170 | 100 | Plus |
3L | 28103327 | 3L | 15016888..15017111 | 235..456 | 975 | 96.4 | Plus |
Blast to na_te.dros performed on 2019-03-15 17:54:11 has no hits.
AT21341.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:55:11 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 15013573..15013806 | 1..234 | 100 | -> | Plus |
chr3L | 15013869..15014088 | 235..454 | 97 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:16:16 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 1..252 | 75..326 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:40 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 1..252 | 75..326 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:50:01 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 1..252 | 75..326 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:13 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 1..252 | 75..326 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:50:00 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 1..252 | 75..326 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:06 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 1..456 | 1..454 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:40 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 1..456 | 1..454 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:50:01 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 1..456 | 1..454 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:14 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 1..456 | 1..454 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:50:00 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32148-RA | 1..456 | 1..454 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:55:11 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15023492..15023725 | 1..234 | 100 | -> | Plus |
3L | 15023788..15024009 | 235..454 | 96 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:55:11 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15023492..15023725 | 1..234 | 100 | -> | Plus |
3L | 15023788..15024009 | 235..454 | 96 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:55:11 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15023492..15023725 | 1..234 | 100 | -> | Plus |
3L | 15023788..15024009 | 235..454 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:50:01 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15016592..15016825 | 1..234 | 100 | -> | Plus |
arm_3L | 15016888..15017109 | 235..454 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:01:55 Download gff for
AT21341.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15016592..15016825 | 1..234 | 100 | -> | Plus |
3L | 15016888..15017109 | 235..454 | 96 | | Plus |
AT21341.hyp Sequence
Translation from 74 to 325
> AT21341.hyp
MSGILLKFLPKNELLHQSLYFCRGMAKKKSQSQGTEKGKKTCNKNQFFGG
CFKKSEPFRRENKKEKSKRCRDPCKDGPCRPEK*
AT21341.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:09:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32148-PA | 83 | CG32148-PA | 1..83 | 1..83 | 459 | 100 | Plus |
AT21341.pep Sequence
Translation from 74 to 325
> AT21341.pep
MSGILLKFLPKNELLHQSLYFCRGMAKKKSQSQGTEKGKKTCNKNQFFGG
CFKKSEPFRRENKKEKSKRCRDPCKDGPCRPEK*
AT21341.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:03:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF23680-PA | 59 | GF23680-PA | 1..59 | 25..83 | 216 | 72.9 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:03:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15713-PA | 83 | GG15713-PA | 1..83 | 1..83 | 359 | 85.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32148-PA | 83 | CG32148-PA | 1..83 | 1..83 | 459 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:03:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25500-PA | 83 | GM25500-PA | 1..83 | 1..83 | 404 | 94 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:03:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14519-PA | 83 | GD14519-PA | 1..83 | 1..83 | 396 | 94 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:03:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK16788-PA | 123 | GK16788-PA | 17..74 | 23..78 | 138 | 58.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:03:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE22044-PA | 83 | GE22044-PA | 1..83 | 1..83 | 386 | 91.6 | Plus |