Clone AT21479 Report

Search the DGRC for AT21479

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:214
Well:79
Vector:pOTB7
Associated Gene/TranscriptCG6485-RA
Protein status:AT21479.pep: gold
Preliminary Size:717
Sequenced Size:904

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6485 2002-01-01 Sim4 clustering to Release 2
CG6485 2002-01-18 Blastp of sequenced clone
CG6485 2003-01-01 Sim4 clustering to Release 3
CG6485 2008-04-29 Release 5.5 accounting
CG6485 2008-08-15 Release 5.9 accounting
CG6485 2008-12-18 5.12 accounting

Clone Sequence Records

AT21479.complete Sequence

904 bp (904 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089390

> AT21479.complete
CCTCGTGCCGAATTCGGCACGAGGATTCAACGTTAGGCGAATCTCATATA
CACAGGGTTAAGTACGTACATATACATATATTTATACCGCTATGCTGCGC
TTGCTTCAGCCCATCCGCCGCATCCACCTGGCACCCGTTCTCCGTTTGGG
AGCACCGGTGAATGCCACTGAAATACGCAAAGCACTGAAGTTCGAGTTCT
CCAAGGATAACCAGCGGAGGGTGAAGGCCCTGCTCGCCTGGTATCCGCAG
GCGGAGTGGAAGGGAGCACTCCTGCCACTACTGGATATTGCCCAGCGGCA
GCAGGGATGGCTTTCGATCAGTGCCGTTCAGGCCGTGGCCGAGACCATCA
AGATAGATCCAATGGAGGCCTTCGAGGCGGCGCAGTTCTACACCATGTTC
TTCATGAAGCCGCGCGGGAAATATGTGGTCAGTGTGTGCACCTCGACGCC
CTGCAAATTGCGTGGGGGCGACGAAATCTTTGAGGCGTGCAAGAAAACGC
TCAATCTAGAGCACGGCCAGACCACGCCGGACATGCAGTTCACGCTCAAG
GAGGATTACTGCATGGGCGCCTGTGTGAATGCCCCCGTTCTGGCGGTCAA
CGATGACATGTACGAGGACCTGGACGAGAAGAGTCTGGCCAACATCCTGG
CGGATCTGCGCAATGACAAGTTGCCGCCCGCTGGTCCGCGCAACGGTAGG
TTTGCCAGTGAGCCCAAGGGTGGACTTACCACCCTAAAGATCCAGCCACC
GCCGCCCGGCTTCATGATGCAGAAACTACCAGATCCGAAGACCAAGAAGT
GTCAGTAGCCATTGATTAAGTCTTAAAGCAATAAATTCCGCCTGCCTTCG
GGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

AT21479.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG6485-RA 843 CG6485-RA 16..843 25..852 4110 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17309404..17310231 852..25 4125 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:55:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17319967..17320796 854..25 4120 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:57:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17313067..17313896 854..25 4120 99.7 Minus
Blast to na_te.dros performed on 2019-03-16 18:42:52 has no hits.

AT21479.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:44:08 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17309404..17310231 25..852 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:16:28 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
CG6485-RA 1..717 92..808 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:47:00 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
CG6485-RA 1..717 92..808 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:37 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
CG6485-RA 1..717 92..808 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:15:03 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
CG6485-RA 1..717 92..808 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:47:34 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
CG6485-RA 1..717 92..808 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:11:13 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
CG6485-RA 16..843 25..852 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:47:00 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
CG6485-RA 16..843 25..852 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:37 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
CG6485-RA 16..843 25..852 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:15:03 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
CG6485-RA 16..843 25..852 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:47:34 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
CG6485-RA 16..843 25..852 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:44:08 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17319969..17320796 25..852 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:44:08 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17319969..17320796 25..852 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:44:08 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17319969..17320796 25..852 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:37 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17313069..17313896 25..852 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:48:47 Download gff for AT21479.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17313069..17313896 25..852 99   Minus

AT21479.pep Sequence

Translation from 91 to 807

> AT21479.pep
MLRLLQPIRRIHLAPVLRLGAPVNATEIRKALKFEFSKDNQRRVKALLAW
YPQAEWKGALLPLLDIAQRQQGWLSISAVQAVAETIKIDPMEAFEAAQFY
TMFFMKPRGKYVVSVCTSTPCKLRGGDEIFEACKKTLNLEHGQTTPDMQF
TLKEDYCMGACVNAPVLAVNDDMYEDLDEKSLANILADLRNDKLPPAGPR
NGRFASEPKGGLTTLKIQPPPPGFMMQKLPDPKTKKCQ*

AT21479.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24324-PA 236 GF24324-PA 1..236 1..233 913 69.1 Plus
Dana\GF22392-PA 242 GF22392-PA 44..239 32..227 614 57.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15826-PA 238 GG15826-PA 1..238 1..238 1160 91.2 Plus
Dere\GG19123-PA 242 GG19123-PA 44..239 32..227 609 55.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14917-PA 248 GH14917-PA 7..248 3..237 651 51 Plus
Dgri\GH24933-PA 242 GH24933-PA 39..239 27..227 611 54.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
ND-24L-PA 238 CG6485-PA 1..238 1..238 1254 100 Plus
ND-24-PB 242 CG5703-PB 44..239 32..227 600 55.6 Plus
ND-24-PA 242 CG5703-PA 44..239 32..227 600 55.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12897-PA 246 GI12897-PA 5..246 1..237 651 51 Plus
Dmoj\GI14890-PA 242 GI14890-PA 46..239 34..227 605 56.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20163-PA 264 GL20163-PA 46..240 34..228 597 54.4 Plus
Dper\GL15498-PA 190 GL15498-PA 27..173 17..163 512 62.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19629-PA 245 GA19629-PA 14..245 3..235 747 59.7 Plus
Dpse\GA19069-PA 264 GA19069-PA 44..240 32..228 596 53.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:23:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24346-PA 241 GM24346-PA 1..241 1..238 1219 95.9 Plus
Dsec\GM13517-PA 242 GM13517-PA 44..239 32..227 610 55.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:23:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12420-PA 238 GD12420-PA 1..238 1..238 1234 97.1 Plus
Dsim\GD15675-PA 242 GD15675-PA 44..239 32..227 610 55.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13038-PA 247 GJ13038-PA 5..247 1..237 676 53.9 Plus
Dvir\GJ15322-PA 129 GJ15322-PA 1..126 102..227 397 57.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25091-PA 242 GK25091-PA 46..239 34..227 613 56.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:23:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22166-PA 241 GE22166-PA 1..241 1..238 1165 91.3 Plus
Dyak\GE17674-PA 242 GE17674-PA 44..239 32..227 609 55.6 Plus

AT21479.hyp Sequence

Translation from 91 to 807

> AT21479.hyp
MLRLLQPIRRIHLAPVLRLGAPVNATEIRKALKFEFSKDNQRRVKALLAW
YPQAEWKGALLPLLDIAQRQQGWLSISAVQAVAETIKIDPMEAFEAAQFY
TMFFMKPRGKYVVSVCTSTPCKLRGGDEIFEACKKTLNLEHGQTTPDMQF
TLKEDYCMGACVNAPVLAVNDDMYEDLDEKSLANILADLRNDKLPPAGPR
NGRFASEPKGGLTTLKIQPPPPGFMMQKLPDPKTKKCQ*

AT21479.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG6485-PA 238 CG6485-PA 1..238 1..238 1254 100 Plus
CG5703-PB 242 CG5703-PB 44..239 32..227 600 55.6 Plus
CG5703-PA 242 CG5703-PA 44..239 32..227 600 55.6 Plus