Clone AT21490 Report

Search the DGRC for AT21490

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:214
Well:90
Vector:pOTB7
Associated Gene/TranscriptCG6497-RA
Protein status:AT21490.pep: gold
Preliminary Size:837
Sequenced Size:1265

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6497 2002-01-01 Sim4 clustering to Release 2
CG6497 2002-05-18 Blastp of sequenced clone
CG6497 2003-01-01 Sim4 clustering to Release 3
CG6497 2008-04-29 Release 5.5 accounting
CG6497 2008-08-15 Release 5.9 accounting
CG6497 2008-12-18 5.12 accounting

Clone Sequence Records

AT21490.complete Sequence

1265 bp (1265 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118703

> AT21490.complete
GGAACATAAGTACCAAAATTAACCGAAACGAAAATTCAAACCCAGTCGGA
CTCATCCCCTACCAGCCAGGAACCATACACCGAAAAAAGAAGGAACCAAA
GGACACAGGACATAATGGAGCTGTGGCAGAAGCTACGAGTGCAGTTTAAT
GACTTCTTCCACGCGAACTACCCGTACATAGCGCTCTACAGCGGACTGGG
CGTGGCAGTAACAGCCTACTTGCACTACCAATGGAGCGTGCACCACTACG
ACCTCATGTACTGGAAGCGTTTGGCGGAGGTCTTCTCGCAGGACATCGAC
TGCATCCAGCTGGCTATACTGCTCTTGATCTTCGCGATCAACGCCATTTT
CGTATTCATCATCCTGAGCGTCTATCTGCGCCCAGCCCTCGACAATGGCA
GTGAGATGTCCTTGCTGGAGATCAAGGATCGCTATGCCCGGTTCATACTG
CTCCGCCTGATAGCCCGTCTCGATCGCATACAGTCGAAGATCTCAGCGAA
GCGTAAGAGCCTCACCTTCCAGCACTATGTGAGGGCACACACGAACATGG
TAAAGGCGGTGGCCGTGTTCCGCAAGGATGCACGCAAGCTAATCCTGCCG
AATGAGAGCGAGATCCTGATGCCCATCGAGGACATCTACGGGGTGGCTGA
TGACGAAGAACGACTGCTTCGGCGATCGGGCTACTACAAGCTGATCATCG
ACACCACCGACGAGACGGTCAAGTCTCTGTTCAACGCCAAGCTGGAGGAG
ATCCTGTTCCCAACCAGCTAGACGACTCGGCGGTTCCGATTGAAACTTTG
AGTAAACTGCAGTCCAACACTAATTGCCTTTATCTACTCTGCCAGAGCCG
CAGCTCCGAGGGCCCCTTCTTAAAGCCGTTTTATTGTTTCAATTGTTTGG
CTTGCCAGCTTTTTATGGCCGCATTGTGCGCCGGGCCAACAATAACAGGC
CAGTCGGAGACTGTCAGCCGTCCCCAACCCCCAATAACAATAATGGCAAA
AGAAACAGCAGCAGAAACAGCAGCAGAAACAGAAGCAGAAGCAGTTGCAG
AACCAGACCAGAACTAGAAACAAAACTCCAACCAGGAACAGAGACTAAAC
TAAAATGCCAGCCCATGTCTGCACAGCTCAAAACAATATCTAATGTTGTC
TACGGCAAAATATTTTGCAAAGCGTCTTTTTGTTTTGCCCGATTTCTGTG
TCCTTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

AT21490.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG6497-RA 1277 CG6497-RA 67..1273 1..1207 6005 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17242171..17243376 1206..1 6000 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:55:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17252731..17253937 1207..1 6005 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17245831..17247037 1207..1 6005 99.8 Minus
Blast to na_te.dros performed on 2019-03-16 18:42:55 has no hits.

AT21490.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:44:10 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17242396..17243376 1..981 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:16:31 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
CG6497-RA 1..657 115..771 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:50 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
CG6497-RA 1..657 115..771 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:40 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
CG6497-RA 1..657 115..771 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:39:08 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
CG6497-RA 1..657 115..771 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:47:36 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
CG6497-RA 1..657 115..771 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:22:37 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
CG6497-RA 67..1272 1..1206 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:50 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
CG6497-RA 67..1272 1..1206 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:40 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
CG6497-RA 1..1206 1..1206 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:39:08 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
CG6497-RA 67..1272 1..1206 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:47:36 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
CG6497-RA 1..1206 1..1206 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:44:10 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17252732..17253937 1..1206 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:44:10 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17252732..17253937 1..1206 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:44:10 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17252732..17253937 1..1206 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:40 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17245832..17247037 1..1206 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:11:31 Download gff for AT21490.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17245832..17247037 1..1206 99   Minus

AT21490.pep Sequence

Translation from 114 to 770

> AT21490.pep
MELWQKLRVQFNDFFHANYPYIALYSGLGVAVTAYLHYQWSVHHYDLMYW
KRLAEVFSQDIDCIQLAILLLIFAINAIFVFIILSVYLRPALDNGSEMSL
LEIKDRYARFILLRLIARLDRIQSKISAKRKSLTFQHYVRAHTNMVKAVA
VFRKDARKLILPNESEILMPIEDIYGVADDEERLLRRSGYYKLIIDTTDE
TVKSLFNAKLEEILFPTS*

AT21490.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24325-PA 209 GF24325-PA 1..209 1..209 931 82.8 Plus
Dana\GF24323-PA 207 GF24323-PA 6..207 2..199 160 27.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15827-PA 218 GG15827-PA 1..218 1..218 1100 95 Plus
Dere\GG15825-PA 203 GG15825-PA 18..184 18..190 153 27.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15304-PA 211 GH15304-PA 1..210 1..208 622 62.4 Plus
Dgri\GH16584-PA 194 GH16584-PA 14..174 22..194 145 26.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG6497-PB 218 CG6497-PB 1..218 1..218 1108 100 Plus
CG6497-PA 218 CG6497-PA 1..218 1..218 1108 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12898-PA 210 GI12898-PA 1..210 1..209 689 66.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15499-PA 384 GL15499-PA 194..384 20..209 658 64.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19639-PA 210 GA19639-PA 1..210 1..209 697 62.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24347-PA 218 GM24347-PA 1..218 1..218 1133 98.6 Plus
Dsec\GM24345-PA 198 GM24345-PA 55..179 64..190 138 29 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12421-PA 218 GD12421-PA 1..218 1..218 1132 98.2 Plus
Dsim\GD12419-PA 189 GD12419-PA 55..179 64..190 145 29.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13039-PA 210 GJ13039-PA 1..210 1..209 688 66.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20350-PA 210 GK20350-PA 6..210 5..209 799 72.7 Plus
Dwil\GK20348-PA 204 GK20348-PA 9..195 9..202 159 23.9 Plus
Dwil\GK19175-PA 214 GK19175-PA 32..213 30..218 145 25.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22167-PA 218 GE22167-PA 1..218 1..218 1080 92.7 Plus

AT21490.hyp Sequence

Translation from 114 to 770

> AT21490.hyp
MELWQKLRVQFNDFFHANYPYIALYSGLGVAVTAYLHYQWSVHHYDLMYW
KRLAEVFSQDIDCIQLAILLLIFAINAIFVFIILSVYLRPALDNGSEMSL
LEIKDRYARFILLRLIARLDRIQSKISAKRKSLTFQHYVRAHTNMVKAVA
VFRKDARKLILPNESEILMPIEDIYGVADDEERLLRRSGYYKLIIDTTDE
TVKSLFNAKLEEILFPTS*

AT21490.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG6497-PB 218 CG6497-PB 1..218 1..218 1108 100 Plus
CG6497-PA 218 CG6497-PA 1..218 1..218 1108 100 Plus