Clone AT21555 Report

Search the DGRC for AT21555

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:215
Well:55
Vector:pOTB7
Associated Gene/TranscriptCG3814-RB
Protein status:AT21555.pep: gold
Preliminary Size:919
Sequenced Size:1052

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3814 2002-01-01 Sim4 clustering to Release 2
CG3814 2002-01-09 Blastp of sequenced clone
CG3814 2003-01-01 Sim4 clustering to Release 3
CG3814 2008-04-29 Release 5.5 accounting
CG3814 2008-08-15 Release 5.9 accounting
CG3814 2008-12-18 5.12 accounting

Clone Sequence Records

AT21555.complete Sequence

1052 bp (1052 high quality bases) assembled on 2002-01-09

GenBank Submission: AY075250

> AT21555.complete
CTCCAGACCATTATCGTCTGCATTTTTGCTTTATCATTGCTTAAGTTAAC
TTTGTTATCTGCACCACCACAGAAAGAAGTCCGGGTGTTTTAATTTCGGG
TTGGCCCCATATCATGCGTTTGACCCGGCCACCTGTTCAGTAGTTCGTGT
GAATTCCAGCAGGGCGTAGCTATAAAATGTATCACTACCAGCAAGGCGAT
GAAACTGGCGCATACACAGATGCGGAAGCGGACAAGAGCTTCGCCTTCGA
TGACCAGAGCATCCGGAAGGGATTTATTCGAAAGGTCTACTTGATATTGA
TGTGCCAATTGCTGATCACTTTCGGTTTTGTTAGCGTATTTACGTTCTCG
AAAGCTTCGCAGGAATGGGTGCAAAAAAATCCGGCACTGTTTTGGATAGC
CTTGGCCGTTCTTATCGTGACCATGATCTGTATGGCCTGCTGCGAAAGTG
TACGCCGTAAGACGCCTCTTAACTTCATCTTTCTTTTCCTGTTCACCGTG
GCGGAGTCGTTCCTTCTGGGTATGGTCGCCGGACAGTTTGAGGCTGATGA
GGTCCTGATGGCAGTGGGAATTACGGCCGCGGTGGCCCTGGGACTCACCC
TGTTTGCCCTGCAGACCAAATACGATTTTACGATGTGCGGAGGAGTGTTG
GTGGCCTGTCTGGTGGTCTTCATCATTTTTGGCATAATCGCTATCTTCAT
CCCAGGCAAGGTGATCGGACTGGTCTATGCCTCCTTGGGAGCATTGCTCT
TCTCCGTTTACTTGGTGTACGATACCCAGTTGATGCTGGGTGGTAATCAT
AAGTACTCCATCAGTCCTGAGGAATACATCTTCGCCGCTCTAAACCTCTA
CCTGGACATTATTAACATCTTCATGTACATACTGACCATTATCGGATTGT
CTCGCAATTAGACTGGTCATTATGATCAATAGCTTCTATTCCAGTTTTAG
AAATGTAACTTAATTTTATGTGCCCAGTGCCACCTTAGCCGGAAAGAAAT
ACAAGACGACTAACTAATCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA

AT21555.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG3814-RB 1142 CG3814-RB 30..1051 1..1022 5050 99.6 Plus
CG3814-RA 1347 CG3814-RA 406..1209 219..1022 3960 99.5 Plus
CG3814-RA 1347 CG3814-RA 1..195 1..195 975 100 Plus
Nmda1.a 1668 Nmda1.a 812..988 719..895 375 80.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8762463..8763079 1020..404 3085 100 Minus
chr2R 21145070 chr2R 8764070..8764265 196..1 980 100 Minus
chr2R 21145070 chr2R 8763400..8763508 302..194 545 100 Minus
chr2R 21145070 chr2R 8763140..8763243 405..302 520 100 Minus
chr2R 21145070 chr2R 8764970..8765315 895..550 395 74.3 Minus
chr3R 27901430 chr3R 9977843..9977997 880..726 295 79.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:55:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12875162..12875780 1022..404 3035 99.4 Minus
2R 25286936 2R 12876771..12876966 196..1 980 100 Minus
2R 25286936 2R 12876101..12876209 302..194 545 100 Minus
2R 25286936 2R 12875841..12875944 405..302 520 100 Minus
2R 25286936 2R 12877671..12878016 895..550 395 74.3 Minus
3R 32079331 3R 14152993..14153147 880..726 295 79.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12876361..12876979 1022..404 3035 99.3 Minus
2R 25260384 2R 12877970..12878165 196..1 980 100 Minus
2R 25260384 2R 12877300..12877408 302..194 545 100 Minus
2R 25260384 2R 12877040..12877143 405..302 520 100 Minus
2R 25260384 2R 12878870..12879046 895..719 375 80.7 Minus
3R 31820162 3R 13893824..13893978 880..726 295 79.3 Minus
Blast to na_te.dros performed on 2019-03-15 15:14:42 has no hits.

AT21555.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:15:40 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8762463..8763078 405..1020 100 <- Minus
chr2R 8763141..8763242 303..404 100 <- Minus
chr2R 8763400..8763506 196..302 100 <- Minus
chr2R 8764071..8764265 1..195 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:16:35 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
CG3814-RB 1..735 177..911 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:53:31 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
CG3814-RB 1..735 177..911 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:08:40 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
CG3814-RB 1..735 177..911 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:18:52 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
CG3814-RB 1..735 177..911 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:32:38 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
CG3814-RB 1..735 177..911 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:16:58 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
CG3814-RB 1..1020 1..1020 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:53:31 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
CG3814-RB 1..1020 1..1020 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:08:40 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
CG3814-RB 1..1020 1..1020 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:18:52 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
CG3814-RB 1..1020 1..1020 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:32:38 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
CG3814-RB 1..1020 1..1020 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:40 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12876101..12876207 196..302 100 <- Minus
2R 12875164..12875779 405..1020 99 <- Minus
2R 12875842..12875943 303..404 100 <- Minus
2R 12876772..12876966 1..195 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:40 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12876101..12876207 196..302 100 <- Minus
2R 12875164..12875779 405..1020 99 <- Minus
2R 12875842..12875943 303..404 100 <- Minus
2R 12876772..12876966 1..195 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:40 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12876101..12876207 196..302 100 <- Minus
2R 12875164..12875779 405..1020 99 <- Minus
2R 12875842..12875943 303..404 100 <- Minus
2R 12876772..12876966 1..195 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:08:40 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8762669..8763284 405..1020 99 <- Minus
arm_2R 8763347..8763448 303..404 100 <- Minus
arm_2R 8763606..8763712 196..302 100 <- Minus
arm_2R 8764277..8764471 1..195 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:53:09 Download gff for AT21555.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12876363..12876978 405..1020 99 <- Minus
2R 12877041..12877142 303..404 100 <- Minus
2R 12877300..12877406 196..302 100 <- Minus
2R 12877971..12878165 1..195 100   Minus

AT21555.pep Sequence

Translation from 176 to 910

> AT21555.pep
MYHYQQGDETGAYTDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFG
FVSVFTFSKASQEWVQKNPALFWIALAVLIVTMICMACCESVRRKTPLNF
IFLFLFTVAESFLLGMVAGQFEADEVLMAVGITAAVALGLTLFALQTKYD
FTMCGGVLVACLVVFIIFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDT
QLMLGGNHKYSISPEEYIFAALNLYLDIINIFMYILTIIGLSRN*

AT21555.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11999-PA 247 GF11999-PA 6..247 3..244 1190 93.4 Plus
Dana\GF11997-PA 323 GF11997-PA 89..323 11..244 892 73.6 Plus
Dana\GF18785-PA 255 GF18785-PA 5..253 3..242 649 51.4 Plus
Dana\GF13645-PA 255 GF13645-PA 30..251 18..239 491 45 Plus
Dana\GF15315-PA 226 GF15315-PA 25..222 45..241 326 36.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22543-PA 244 GG22543-PA 1..244 1..244 1262 99.2 Plus
Dere\GG22542-PA 324 GG22542-PA 90..324 11..244 875 70.2 Plus
Dere\GG21447-PA 264 GG21447-PA 32..261 14..240 629 50 Plus
Dere\GG23314-PA 274 GG23314-PA 31..270 3..239 417 37.5 Plus
Dere\GG24567-PA 221 GG24567-PA 23..218 44..241 239 33.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20517-PA 246 GH20517-PA 5..246 3..244 1066 88.4 Plus
Dgri\GH20515-PA 331 GH20515-PA 97..331 11..244 924 75.7 Plus
Dgri\GH19695-PA 263 GH19695-PA 30..263 11..244 774 61.1 Plus
Dgri\GH23740-PA 263 GH23740-PA 30..263 11..244 761 60.3 Plus
Dgri\GH21302-PA 289 GH21302-PA 61..287 14..240 596 49.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Lfg-PB 244 CG3814-PB 1..244 1..244 1238 100 Plus
Lfg-PD 239 CG3814-PD 10..239 15..244 1157 100 Plus
Lfg-PA 239 CG3814-PA 10..239 15..244 1157 100 Plus
Lfg-PC 203 CG3814-PC 1..203 42..244 1023 100 Plus
Nmda1-PH 313 CG3798-PH 79..313 11..244 877 71.5 Plus
Nmda1-PG 313 CG3798-PG 79..313 11..244 877 71.5 Plus
Nmda1-PA 313 CG3798-PA 79..313 11..244 877 71.5 Plus
Nmda1-PB 313 CG3798-PB 79..313 11..244 877 71.5 Plus
Nmda1-PI 316 CG3798-PI 82..316 11..244 877 71.5 Plus
Nmda1-PF 316 CG3798-PF 82..316 11..244 877 71.5 Plus
Nmda1-PE 324 CG3798-PE 90..324 11..244 877 71.5 Plus
Nmda1-PC 324 CG3798-PC 90..324 11..244 877 71.5 Plus
Nmda1-PD 324 CG3798-PD 90..324 11..244 877 71.5 Plus
CG9722-PA 264 CG9722-PA 38..261 17..240 653 54.9 Plus
CG30379-PB 295 CG30379-PB 72..291 20..239 454 37.7 Plus
CG33673-PB 235 CG33673-PB 16..232 24..241 346 33.8 Plus
CG34430-PA 264 CG34430-PA 30..232 20..228 198 28.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21062-PA 244 GI21062-PA 1..244 1..244 1154 88.1 Plus
Dmoj\GI21061-PA 324 GI21061-PA 90..324 11..244 890 72.3 Plus
Dmoj\GI24550-PA 263 GI24550-PA 32..263 14..244 786 62.1 Plus
Dmoj\GI19790-PA 285 GI19790-PA 57..279 15..236 550 50.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17451-PA 245 GL17451-PA 4..245 3..244 1096 90.9 Plus
Dper\GL17450-PA 319 GL17450-PA 85..319 11..244 903 71.9 Plus
Dper\GL23305-PA 282 GL23305-PA 26..252 4..236 668 59.2 Plus
Dper\GL11699-PA 304 GL11699-PA 77..300 16..239 534 46.4 Plus
Dper\GL18462-PA 223 GL18462-PA 22..214 43..235 338 38.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17704-PA 245 GA17704-PA 4..245 3..244 1101 91.3 Plus
Dpse\GA17704-PB 237 GA17704-PB 8..237 15..244 1039 91.7 Plus
Dpse\GA17693-PC 308 GA17693-PC 74..308 11..244 903 71.9 Plus
Dpse\GA17693-PB 310 GA17693-PB 76..310 11..244 903 71.9 Plus
Dpse\GA17693-PA 319 GA17693-PA 85..319 11..244 903 71.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20328-PA 244 GM20328-PA 1..244 1..244 1261 99.2 Plus
Dsec\GM20327-PA 324 GM20327-PA 90..324 11..244 890 71.5 Plus
Dsec\GM25879-PA 264 GM25879-PA 38..263 17..242 640 54 Plus
Dsec\GM20992-PA 243 GM20992-PA 41..239 9..239 377 33.8 Plus
Dsec\GM16580-PA 222 GM16580-PA 24..219 40..241 250 33.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25805-PA 244 GD25805-PA 1..244 1..244 1261 99.2 Plus
Dsim\GD25804-PA 324 GD25804-PA 90..324 11..244 893 71.5 Plus
Dsim\GD20449-PA 262 GD20449-PA 36..261 17..242 643 54.4 Plus
Dsim\GD10521-PA 284 GD10521-PA 50..280 9..239 433 36.4 Plus
Dsim\GD10520-PA 275 GD10520-PA 41..271 9..239 427 36.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21986-PA 244 GJ21986-PA 1..244 1..244 1172 90.2 Plus
Dvir\GJ21985-PA 333 GJ21985-PA 96..333 8..244 883 71.4 Plus
Dvir\GJ22617-PA 262 GJ22617-PA 15..262 4..244 855 64.5 Plus
Dvir\GJ15114-PA 302 GJ15114-PA 72..299 10..238 578 49.8 Plus
Dvir\GJ22864-PA 199 GJ22864-PA 9..196 53..241 311 41.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20879-PA 244 GK20879-PA 1..244 1..244 1111 85.2 Plus
Dwil\GK20878-PA 323 GK20878-PA 89..323 11..244 902 71.5 Plus
Dwil\GK19213-PA 271 GK19213-PA 42..271 14..243 740 60 Plus
Dwil\GK21973-PA 299 GK21973-PA 69..297 10..240 590 49.4 Plus
Dwil\GK20410-PA 176 GK20410-PA 9..173 53..217 225 31.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13413-PA 244 GE13413-PA 1..244 1..244 1266 99.6 Plus
Dyak\GE13412-PA 324 GE13412-PA 90..324 11..244 880 70.2 Plus
Dyak\GE10054-PA 264 GE10054-PA 38..263 17..242 669 56.2 Plus
Dyak\GE19159-PA 242 GE19159-PA 36..238 5..239 388 34.5 Plus
Dyak\GE15302-PA 223 GE15302-PA 23..219 44..241 263 33.7 Plus

AT21555.hyp Sequence

Translation from 176 to 910

> AT21555.hyp
MYHYQQGDETGAYTDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFG
FVSVFTFSKASQEWVQKNPALFWIALAVLIVTMICMACCESVRRKTPLNF
IFLFLFTVAESFLLGMVAGQFEADEVLMAVGITAAVALGLTLFALQTKYD
FTMCGGVLVACLVVFIIFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDT
QLMLGGNHKYSISPEEYIFAALNLYLDIINIFMYILTIIGLSRN*

AT21555.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG3814-PB 244 CG3814-PB 1..244 1..244 1238 100 Plus
CG3814-PD 239 CG3814-PD 10..239 15..244 1157 100 Plus
CG3814-PA 239 CG3814-PA 10..239 15..244 1157 100 Plus
CG3814-PC 203 CG3814-PC 1..203 42..244 1023 100 Plus
Nmda1-PH 313 CG3798-PH 79..313 11..244 877 71.5 Plus