Clone AT21561 Report

Search the DGRC for AT21561

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:215
Well:61
Vector:pOTB7
Associated Gene/TranscriptCG31910-RA
Protein status:AT21561.pep: gold
Sequenced Size:874

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11323 2002-01-01 Sim4 clustering to Release 2
CG31910 2002-01-09 Blastp of sequenced clone
CG31910 2003-01-01 Sim4 clustering to Release 3
CG31910 2008-04-29 Release 5.5 accounting
CG31910 2008-08-15 Release 5.9 accounting
CG31910 2008-12-18 5.12 accounting

Clone Sequence Records

AT21561.complete Sequence

874 bp (874 high quality bases) assembled on 2002-01-09

GenBank Submission: AY089392

> AT21561.complete
TAAACAAAATGGAACACAGAGTTGAATTGATGTTGGAACCCATAGTGGCG
GGCAAGTTGGAGCGCAGATCGGATAACAGATCAAACAAGGTGGAGGATGA
GGAGCCGCATCTAACCAAGCAGCTCAAGAAGCACTACGGGATTGAGGCAG
AAGTTCTGGGTCTCCTTGTCAAGTTAGAGATGCGTTATAAGGAATACTAC
AATCTATACAAGTGCGAAATGAAGGCCCAAAAGATACTGGTTGAACGGAT
ATGGCTGCTAACCCAGCGATATCTGATTCTAATCAGTTCAGAGCAGAGCT
GTCGCTATCCCGAAGTGTACACCTTGTCCACCGAGGAGGCCATTATCAAT
GAATATGAGGAAAAATTGGAAGTGCTGCGAGCTTCAAACAACAAAATGAA
AAACACCCTGTTGGAAATCAATCAGCAGTGCAAGGAGTTCTATGCCGCCT
ACGAACGGCTGGACAAGGCACAGGAAACGCCTTTCATCATGGGCGATAGC
CATCATAGAAGCATCAAGTACCACAAGATCATGGCCGTCGACATATTCAA
CTATTTGTATGCAACAGTGCTGAAGCTCAAGTGCTTCATGCATCAGCTGG
ATCCCGTGAATCTGGAGAGTGTCGAGGAATACCGCGATCTGCTCCAAAAC
GAATCCGCCATGGAGGAGTTTGAGGAGTATCTTAACAATCAATTTGTCTA
CTGCAAGTGTATCTACCCGATTCCAACCTGCCCCATCTTGAAGCTGAAGT
GTTCCCACCAAAACATAGCAAATTTAAAGTATGTCAGTCGCATCTAGTCA
AGCCAAAATGTGCAATAAATAGAAGCCCTATTCAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAA

AT21561.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG31910-RA 1067 CG31910-RA 141..975 1..835 4130 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6743711..6744155 833..389 2180 99.3 Minus
chr2L 23010047 chr2L 6744211..6744598 388..1 1940 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 15:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
snoRNA:Me28S-G2743-RA 79 CR34663-RA 1..79 496..418 350 96.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6744661..6745107 835..389 2190 99.3 Minus
2L 23513712 2L 6745163..6745550 388..1 1940 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6744661..6745107 835..389 2190 99.3 Minus
2L 23513712 2L 6745163..6745550 388..1 1940 100 Minus
Blast to na_te.dros performed 2019-03-16 05:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\BuT2 2775 Dbuz\BuT2 BUT2 2775bp 477..539 702..763 114 66.7 Plus
TART-A 13424 TART-A 13424bp 2005..2063 353..410 112 67.8 Plus

AT21561.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:57:15 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6743711..6744155 389..833 99 <- Minus
chr2L 6744211..6744598 1..388 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:16:38 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
CG31910-RA 1..789 9..797 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:58 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
CG31910-RA 1..789 9..797 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:48 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
CG31910-RA 1..789 9..797 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:30 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
CG31910-RA 1..789 9..797 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:11:58 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
CG31910-RA 1..789 9..797 99   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 15:55:37 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
snoRNA:Me28S-G2743-RA 1..79 418..496 96   Minus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:07 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
CG31910-RA 60..892 1..833 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:58 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
CG31910-RA 60..892 1..833 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:48 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
CG31910-RA 73..905 1..833 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:30 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
CG31910-RA 60..892 1..833 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:11:58 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
CG31910-RA 73..905 1..833 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:15 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6744663..6745107 389..833 99 <- Minus
2L 6745163..6745550 1..388 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:15 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6744663..6745107 389..833 99 <- Minus
2L 6745163..6745550 1..388 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:57:15 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6744663..6745107 389..833 99 <- Minus
2L 6745163..6745550 1..388 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:48 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6744663..6745107 389..833 99 <- Minus
arm_2L 6745163..6745550 1..388 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:21 Download gff for AT21561.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6744663..6745107 389..833 99 <- Minus
2L 6745163..6745550 1..388 100   Minus

AT21561.hyp Sequence

Translation from 2 to 796

> AT21561.hyp
NKMEHRVELMLEPIVAGKLERRSDNRSNKVEDEEPHLTKQLKKHYGIEAE
VLGLLVKLEMRYKEYYNLYKCEMKAQKILVERIWLLTQRYLILISSEQSC
RYPEVYTLSTEEAIINEYEEKLEVLRASNNKMKNTLLEINQQCKEFYAAY
ERLDKAQETPFIMGDSHHRSIKYHKIMAVDIFNYLYATVLKLKCFMHQLD
PVNLESVEEYRDLLQNESAMEEFEEYLNNQFVYCKCIYPIPTCPILKLKC
SHQNIANLKYVSRI*

AT21561.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG31910-PA 262 CG31910-PA 1..262 3..264 1369 100 Plus
CG30391-PA 338 CG30391-PA 34..234 41..244 325 30.9 Plus
CG30393-PA 354 CG30393-PA 39..234 46..244 300 31.7 Plus

AT21561.pep Sequence

Translation from 8 to 796

> AT21561.pep
MEHRVELMLEPIVAGKLERRSDNRSNKVEDEEPHLTKQLKKHYGIEAEVL
GLLVKLEMRYKEYYNLYKCEMKAQKILVERIWLLTQRYLILISSEQSCRY
PEVYTLSTEEAIINEYEEKLEVLRASNNKMKNTLLEINQQCKEFYAAYER
LDKAQETPFIMGDSHHRSIKYHKIMAVDIFNYLYATVLKLKCFMHQLDPV
NLESVEEYRDLLQNESAMEEFEEYLNNQFVYCKCIYPIPTCPILKLKCSH
QNIANLKYVSRI*

AT21561.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14483-PA 249 GF14483-PA 7..249 15..262 897 71.4 Plus
Dana\GF12111-PA 349 GF12111-PA 48..240 46..241 346 35 Plus
Dana\GF18863-PA 367 GF18863-PA 148..287 87..234 150 25.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23587-PA 262 GG23587-PA 1..262 1..262 1257 90.5 Plus
Dere\GG20791-PA 323 GG20791-PA 39..234 44..242 274 31.5 Plus
Dere\GG20790-PA 365 GG20790-PA 34..234 39..242 266 29.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10791-PA 235 GH10791-PA 4..230 30..256 827 65.2 Plus
Dgri\GH20032-PA 333 GH20032-PA 26..230 33..242 330 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG31910-PA 262 CG31910-PA 1..262 1..262 1369 100 Plus
CG30391-PA 338 CG30391-PA 34..234 39..242 325 30.9 Plus
CG30393-PA 354 CG30393-PA 39..234 44..242 300 31.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17302-PA 236 GI17302-PA 3..236 29..262 838 63.7 Plus
Dmoj\GI19210-PA 339 GI19210-PA 37..236 40..244 333 32.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25964-PA 254 GL25964-PA 25..254 33..262 894 71.7 Plus
Dper\GL10759-PA 341 GL10759-PA 44..251 44..254 323 32.7 Plus
Dper\GL15157-PA 226 GL15157-PA 1..158 92..252 215 31.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16557-PA 254 GA16557-PA 25..254 33..262 891 71.7 Plus
Dpse\GA15812-PA 341 GA15812-PA 44..251 44..254 320 32.7 Plus
Dpse\GA22788-PA 248 GA22788-PA 43..237 44..241 291 32.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13880-PA 262 GM13880-PA 1..262 1..262 1326 96.2 Plus
Dsec\GM15737-PA 365 GM15737-PA 34..234 39..242 314 32.7 Plus
Dsec\GM15736-PA 360 GM15736-PA 39..234 44..242 273 30.2 Plus
Dsec\GM26449-PA 362 GM26449-PA 149..317 87..257 150 27.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22546-PA 262 GD22546-PA 1..262 1..262 1340 96.9 Plus
Dsim\GD25214-PA 365 GD25214-PA 34..234 39..242 317 33.2 Plus
Dsim\GD25213-PA 360 GD25213-PA 39..234 44..242 290 31.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15702-PA 236 GJ15702-PA 3..236 29..262 870 67.1 Plus
Dvir\GJ20280-PA 358 GJ20280-PA 43..240 40..242 355 36 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24215-PA 239 GK24215-PA 7..239 30..262 854 66.1 Plus
Dwil\GK15800-PA 313 GK15800-PA 23..223 38..241 356 34.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18408-PA 261 GE18408-PA 1..261 1..262 1247 90.5 Plus
Dyak\GE13729-PA 327 GE13729-PA 39..234 44..242 313 32 Plus
Dyak\GE13728-PA 367 GE13728-PA 34..234 39..242 275 29.4 Plus