Clone AT21612 Report

Search the DGRC for AT21612

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:216
Well:12
Vector:pOTB7
Associated Gene/TranscriptRoc1b-RA
Protein status:AT21612.pep: gold
Preliminary Size:560
Sequenced Size:553

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16988 2001-12-16 Blastp of sequenced clone
CG16988 2002-01-01 Sim4 clustering to Release 2
CG16988 2003-01-01 Sim4 clustering to Release 3
Roc1b 2008-04-29 Release 5.5 accounting
Roc1b 2008-08-15 Release 5.9 accounting
Roc1b 2008-12-18 5.12 accounting

Clone Sequence Records

AT21612.complete Sequence

553 bp (553 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070810

> AT21612.complete
AAAATAAGTGTTGTATTTTGAAAAAGAAAAAAAATTCGTAATTTCACACC
ATGGCCGAGGAGATAGAGGTTGAGGAGACGGAGGACTTCCACGACATGGA
CTTCAATGACGAAGAGCCATCCTGTAGTGGAGGAGCTGTCCAGGCCAGGA
CGGAGCGCTTTGTGGTGAAGAAATGGGTTGCGCACGCCATGTGGGGATGG
GACGTAGCAGTGGACAACTGTGCCATCTGCCGTAACCACATCATGAACCT
GTGCATCGAGTGCCAGGCGGACCCGAATGCAAACCAAGACGAGTGCACTG
TGGCTTGGGGCGAGTGCAACCACGCATTCCATTACCACTGCATCGCGCGC
TGGTTGAAAACGCGCCTGGTCTGTCCGCTGGACAACAAGGAGTGGGTCTA
CCAGAAGTACGGCCGCTAGCGAGGAATATGGATCGGGATATTAGGTGGTG
ATAGCTGTTTGCTGGCATGTAATTACTGTAATTAAATAAGAACGGACTTG
GGTTCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

AT21612.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG6905-RA 3392 CG6905-RA 2721..3230 510..1 2550 100 Minus
CG6905-RB 3392 CG6905-RB 2721..3230 510..1 2550 100 Minus
Roc1b-RA 506 Roc1b-RA 1..506 1..506 2530 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 357934..358439 1..506 2530 100 Plus
chrX 22417052 chrX 541697..541908 210..418 410 80.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:55:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 357981..358490 1..510 2550 100 Plus
X 23542271 X 647711..647922 210..418 410 80.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 357981..358490 1..510 2550 100 Plus
X 23527363 X 655893..656020 291..418 310 82.8 Plus
X 23527363 X 655809..655872 210..273 230 90.6 Plus
Blast to na_te.dros performed on 2019-03-16 08:40:33 has no hits.

AT21612.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:41:46 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 357934..358439 1..506 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:16:44 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1b-RA 1..369 51..419 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:42 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1b-RA 1..369 51..419 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:04 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1b-RA 1..369 51..419 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:14 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1b-RA 1..369 51..419 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:45:38 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1b-RA 1..369 51..419 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:08 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
CG6905-RA 2711..3216 1..506 100   Minus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:41 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
CG6905-RA 2711..3216 1..506 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:04 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1b-RA 1..506 1..506 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:15 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
CG6905-RA 2711..3216 1..506 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:45:38 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
Roc1b-RA 1..506 1..506 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:41:46 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
3L 357981..358486 1..506 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:41:46 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
3L 357981..358486 1..506 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:41:46 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
3L 357981..358486 1..506 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:04 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 357981..358486 1..506 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:01:56 Download gff for AT21612.complete
Subject Subject Range Query Range Percent Splice Strand
3L 357981..358486 1..506 100   Plus

AT21612.pep Sequence

Translation from 50 to 418

> AT21612.pep
MAEEIEVEETEDFHDMDFNDEEPSCSGGAVQARTERFVVKKWVAHAMWGW
DVAVDNCAICRNHIMNLCIECQADPNANQDECTVAWGECNHAFHYHCIAR
WLKTRLVCPLDNKEWVYQKYGR*

AT21612.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24894-PA 119 GF24894-PA 1..118 1..121 495 85.2 Plus
Dana\GF20493-PA 194 GF20493-PA 88..194 15..122 389 66.1 Plus
Dana\GF13953-PA 108 GF13953-PA 1..107 16..121 376 63.6 Plus
Dana\GF22186-PA 108 GF22186-PA 1..107 16..121 376 63.6 Plus
Dana\GF21496-PA 146 GF21496-PA 41..145 19..121 369 66.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14721-PA 122 GG14721-PA 1..121 1..121 637 98.3 Plus
Dere\GG12803-PA 108 GG12803-PA 1..107 16..121 376 63.6 Plus
Dere\GG22636-PA 113 GG22636-PA 7..113 19..122 235 42.1 Plus
Dere\GG24061-PA 85 GG24061-PA 2..82 36..117 148 36.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15458-PA 128 GH15458-PA 21..127 12..121 480 81.8 Plus
Dgri\GH22607-PA 128 GH22607-PA 21..127 12..121 479 81.8 Plus
Dgri\GH23818-PA 128 GH23818-PA 21..127 12..121 479 81.8 Plus
Dgri\GH10088-PA 159 GH10088-PA 41..159 4..122 383 60.3 Plus
Dgri\GH17811-PA 108 GH17811-PA 1..107 16..121 376 63.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1b-PA 122 CG16988-PA 1..122 1..122 705 100 Plus
Roc1a-PD 108 CG16982-PD 9..107 21..121 395 67.6 Plus
Roc1a-PA 108 CG16982-PA 9..107 21..121 395 67.6 Plus
Roc1a-PC 136 CG16982-PC 53..135 40..121 376 73.5 Plus
Roc2-PB 113 CG8998-PB 4..113 15..122 263 42.3 Plus
Roc2-PA 113 CG8998-PA 4..113 15..122 263 42.3 Plus
lmgA-PB 85 CG34440-PB 2..82 36..117 176 36.5 Plus
lmgA-PA 85 CG18042-PA 2..82 36..117 176 36.5 Plus
lmgA-PD 85 CG34440-PD 2..82 36..117 176 36.5 Plus
lmgA-PC 85 CG34440-PC 2..82 36..117 176 36.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16738-PA 130 GI16738-PA 21..129 12..121 478 82.9 Plus
Dmoj\GI14277-PA 159 GI14277-PA 59..159 22..122 377 67.6 Plus
Dmoj\GI16422-PA 108 GI16422-PA 1..107 16..121 372 62.6 Plus
Dmoj\GI20142-PA 147 GI20142-PA 59..147 35..122 341 68.5 Plus
Dmoj\GI21036-PA 111 GI21036-PA 23..111 37..122 228 47.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22584-PA 123 GL22584-PA 1..122 1..121 513 78.9 Plus
Dper\GL14784-PA 284 GL14784-PA 182..284 20..122 396 69.2 Plus
Dper\GL13357-PA 108 GL13357-PA 1..107 16..121 376 63.6 Plus
Dper\GL10569-PA 102 GL10569-PA 6..102 27..122 285 55.7 Plus
Dper\GL10672-PA 113 GL10672-PA 25..113 37..122 234 48.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14260-PA 123 GA14260-PA 1..122 1..121 512 78.9 Plus
Dpse\GA23017-PA 150 GA23017-PA 48..150 20..122 386 70.2 Plus
Dpse\GA22841-PA 108 GA22841-PA 1..107 16..121 376 63.6 Plus
Dpse\GA24410-PA 102 GA24410-PA 6..102 27..122 285 55.7 Plus
Dpse\GA21465-PA 113 GA21465-PA 25..113 37..122 234 48.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14339-PA 122 GM14339-PA 1..122 1..122 643 98.4 Plus
Dsec\GM19082-PA 108 GM19082-PA 1..107 16..121 364 61.7 Plus
Dsec\GM20415-PA 113 GM20415-PA 10..113 21..122 235 43.8 Plus
Dsec\GM12813-PA 85 GM12813-PA 2..82 36..117 148 36.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11014-PA 122 GD11014-PA 1..122 1..122 643 98.4 Plus
Dsim\GD16520-PA 108 GD16520-PA 1..107 16..121 364 61.7 Plus
Dsim\GD25891-PA 113 GD25891-PA 10..113 21..122 235 43.8 Plus
Dsim\GD22391-PA 85 GD22391-PA 2..82 36..117 148 36.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12485-PA 131 GJ12485-PA 21..130 12..121 494 82.7 Plus
Dvir\GJ16241-PA 149 GJ16241-PA 49..149 22..122 386 68.6 Plus
Dvir\GJ15825-PA 108 GJ15825-PA 1..107 16..121 376 63.6 Plus
Dvir\GJ22419-PA 117 GJ22419-PA 29..117 35..122 339 68.5 Plus
Dvir\GJ15904-PA 104 GJ15904-PA 13..103 31..118 243 49.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13170-PA 121 GK13170-PA 1..121 1..122 475 78.9 Plus
Dwil\GK18099-PA 160 GK18099-PA 44..160 6..122 413 66.9 Plus
Dwil\GK16427-PA 108 GK16427-PA 1..107 16..121 376 63.6 Plus
Dwil\GK20357-PA 123 GK20357-PA 16..122 8..121 373 59.6 Plus
Dwil\GK15981-PA 112 GK15981-PA 24..111 35..121 346 70.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21084-PA 122 GE21084-PA 1..121 1..121 572 95 Plus
Dyak\GE17622-PA 137 GE17622-PA 25..136 10..121 554 91.1 Plus
Dyak\GE16630-PA 111 GE16630-PA 3..110 15..121 377 63 Plus
Dyak\GE13508-PA 113 GE13508-PA 10..113 21..122 233 43.8 Plus
Dyak\GE10872-PA 85 GE10872-PA 2..82 36..117 148 36.5 Plus

AT21612.hyp Sequence

Translation from 50 to 418

> AT21612.hyp
MAEEIEVEETEDFHDMDFNDEEPSCSGGAVQARTERFVVKKWVAHAMWGW
DVAVDNCAICRNHIMNLCIECQADPNANQDECTVAWGECNHAFHYHCIAR
WLKTRLVCPLDNKEWVYQKYGR*

AT21612.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Roc1b-PA 122 CG16988-PA 1..122 1..122 705 100 Plus
Roc1a-PD 108 CG16982-PD 9..107 21..121 395 67.6 Plus
Roc1a-PA 108 CG16982-PA 9..107 21..121 395 67.6 Plus
Roc1a-PC 136 CG16982-PC 53..135 40..121 376 73.5 Plus
Roc2-PB 113 CG8998-PB 4..113 15..122 263 42.3 Plus