Clone AT21920 Report

Search the DGRC for AT21920

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:219
Well:20
Vector:pOTB7
Associated Gene/TranscriptCG15708-RA
Protein status:AT21920.pep: gold
Preliminary Size:696
Sequenced Size:944

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15708 2002-01-01 Sim4 clustering to Release 2
CG15708 2002-02-26 Blastp of sequenced clone
CG15708 2003-01-01 Sim4 clustering to Release 3
CG15708 2008-04-29 Release 5.5 accounting
CG15708 2008-08-15 Release 5.9 accounting
CG15708 2008-12-18 5.12 accounting

Clone Sequence Records

AT21920.complete Sequence

944 bp (944 high quality bases) assembled on 2002-02-26

GenBank Submission: AY089394

> AT21920.complete
AAAACCCATTCGTCGTCTAAAGTATTTCACTTTTGTAAAAGTATCTCTAG
AGTTATATAGCGAATGGGGCCATGTCCCAGACAAATCCGAAACCAAGTGA
TACGCAATCACTGCGCTGTTTGCACTGCATGAAGGTGATCCGTTGCTCCC
GCTACGACACCAGTGAACTGGTGCGACACATCCAACAGGATCATCCGGAG
ATATACGCAGTGACCACGGATAAAATCAAGAATCTGCACAAGCTGGCCGC
GGATCACGGCATCAGTGAGGAGCGGCTCTCGAAGATTAGCAAGATGACGG
GTCTGTCCGAGTCCCAGATGGCCGAAAAGGCAGAGAAATATATGGCCAAA
AAGAAGAATTATGGTCGCAGTGGTGGATCTGTCGCCGGTGACCCTGCTGC
CGTCAGTGAAGCCGCCTCCTACAAAACCGAGAAGCCCAGCTCCCCATGTC
CATGTTCACGTCCATTGGAGAACTCGACGTCGCATCGGAGGAAATGCTAT
CGCGCCTCCATCGAACGCTGGGCACCGGCGGAGGGGCGCATCTTTTGTCC
GTGCTGCGCGACCAGCAGGCGGCCGCTTATCAAGGCTGCCACTGAGATCT
CGAACAACGGCTGCTGTGCCGCCTGGGTGGTCTCCTGCTGGCCTCTGTGC
TTCCTGCCCTGCCTCATGTCCGCGGACAACAATGAGTACCTGTACTGCGC
CAATTGCCGCGCCTTTCTGGGCATCTACAATCGCGAGAAAAGCTGTGTGC
AGCCCAGCAAGGAGTTTGTGTCCTGCAGCAAGTCGGTCACGGCCCCGCTC
AAGTGTCCAACTGAAAACCTGTGAAAGGACTTTGAGTGGGCGTAGTACTT
ATTAAATTGGTTGTGTATACATCTGGCTATGTTTTTTTTTTTTAATAAAA
AACAAGTTGTTCGATAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT21920.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG15708-RA 973 CG15708-RA 58..973 1..916 4580 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12128258..12128833 915..340 2880 100 Minus
chr2R 21145070 chr2R 12128890..12129228 339..1 1695 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:55:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16240934..16241511 917..340 2890 100 Minus
2R 25286936 2R 16241568..16241906 339..1 1695 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16242133..16242710 917..340 2890 100 Minus
2R 25260384 2R 16242767..16243105 339..1 1695 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:25:40 has no hits.

AT21920.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:26:24 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12128297..12128833 340..876 100 <- Minus
chr2R 12128890..12129228 1..339 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:36:22 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
CG15708-RA 1..753 72..824 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:28:57 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
CG15708-RA 1..753 72..824 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:07:41 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
CG15708-RA 1..753 72..824 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:33:51 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
CG15708-RA 1..753 72..824 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:01:49 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
CG15708-RA 29..943 1..915 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:36:21 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
CG15708-RA 29..943 1..915 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:28:57 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
CG15708-RA 29..943 1..915 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:07:41 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
CG15708-RA 29..943 1..915 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:33:51 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
CG15708-RA 29..943 1..915 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:24 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16240936..16241511 340..915 100 <- Minus
2R 16241568..16241906 1..339 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:24 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16240936..16241511 340..915 100 <- Minus
2R 16241568..16241906 1..339 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:26:24 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16240936..16241511 340..915 100 <- Minus
2R 16241568..16241906 1..339 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:28:57 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12128441..12129016 340..915 100 <- Minus
arm_2R 12129073..12129411 1..339 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:41:40 Download gff for AT21920.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16242135..16242710 340..915 100 <- Minus
2R 16242767..16243105 1..339 100   Minus

AT21920.pep Sequence

Translation from 71 to 823

> AT21920.pep
MSQTNPKPSDTQSLRCLHCMKVIRCSRYDTSELVRHIQQDHPEIYAVTTD
KIKNLHKLAADHGISEERLSKISKMTGLSESQMAEKAEKYMAKKKNYGRS
GGSVAGDPAAVSEAASYKTEKPSSPCPCSRPLENSTSHRRKCYRASIERW
APAEGRIFCPCCATSRRPLIKAATEISNNGCCAAWVVSCWPLCFLPCLMS
ADNNEYLYCANCRAFLGIYNREKSCVQPSKEFVSCSKSVTAPLKCPTENL
*

AT21920.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11280-PA 248 GF11280-PA 1..239 1..242 780 62.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22287-PA 253 GG22287-PA 1..239 1..240 1070 86.7 Plus
Dere\GG18533-PA 232 GG18533-PA 1..232 1..233 488 41 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19760-PA 223 GH19760-PA 1..221 1..233 588 48.7 Plus
Dgri\GH19759-PA 208 GH19759-PA 1..207 1..234 475 42.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15708-PA 250 CG15708-PA 1..250 1..250 1354 100 Plus
CG12684-PA 231 CG12684-PA 10..228 12..230 379 33.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20297-PA 216 GI20297-PA 7..216 8..237 633 53.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11360-PA 236 GL11360-PA 8..226 10..233 695 56.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13904-PA 236 GA13904-PA 8..226 10..233 688 56.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20075-PA 247 GM20075-PA 1..247 1..250 1201 91.6 Plus
Dsec\GM12681-PA 230 GM12681-PA 11..230 14..233 321 32.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25556-PA 247 GD25556-PA 1..247 1..250 1203 92 Plus
Dsim\GD16290-PA 233 GD16290-PA 1..233 1..233 355 31.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22024-PA 217 GJ22024-PA 4..215 7..233 641 52.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21438-PA 247 GK21438-PA 5..226 8..236 643 52.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14083-PA 253 GE14083-PA 1..253 1..250 1155 86.6 Plus
Dyak\GE16849-PA 236 GE16849-PA 1..236 1..233 473 40.2 Plus

AT21920.hyp Sequence

Translation from 71 to 823

> AT21920.hyp
MSQTNPKPSDTQSLRCLHCMKVIRCSRYDTSELVRHIQQDHPEIYAVTTD
KIKNLHKLAADHGISEERLSKISKMTGLSESQMAEKAEKYMAKKKNYGRS
GGSVAGDPAAVSEAASYKTEKPSSPCPCSRPLENSTSHRRKCYRASIERW
APAEGRIFCPCCATSRRPLIKAATEISNNGCCAAWVVSCWPLCFLPCLMS
ADNNEYLYCANCRAFLGIYNREKSCVQPSKEFVSCSKSVTAPLKCPTENL
*

AT21920.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG15708-PA 250 CG15708-PA 1..250 1..250 1354 100 Plus
CG12684-PA 231 CG12684-PA 10..228 12..230 379 33.5 Plus