BDGP Sequence Production Resources |
Search the DGRC for AT22273
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 222 |
Well: | 73 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG3687-RA |
Protein status: | AT22273.pep: gold |
Preliminary Size: | 771 |
Sequenced Size: | 670 |
Gene | Date | Evidence |
---|---|---|
CG3687 | 2002-01-01 | Sim4 clustering to Release 2 |
CG3687 | 2002-01-03 | Blastp of sequenced clone |
CG3687 | 2003-01-01 | Sim4 clustering to Release 3 |
CG3687 | 2008-04-29 | Release 5.5 accounting |
CG3687 | 2008-08-15 | Release 5.9 accounting |
CG3687 | 2008-12-18 | 5.12 accounting |
670 bp (670 high quality bases) assembled on 2002-01-03
GenBank Submission: AY075261
> AT22273.complete GCTTCGCTTAGCCTGTCTCTCGGAATAGTATTCATCTAACAAGTATTCAT CGAACAAAGAAATCGTATTTTTATAAGCTAAGAAATGTGTGACGAAGGAT CGATCAGGGAATGTGAGCCCACCACCTTGCGGCTTCCTTTCAACAGCTAC CACATCAATTTGCCGCTATATATTTTGGACATGGTGCGCATCTTCCAGGA TCATCCCAAGTACAGCAATGGTATCCACGAGGAGCACATTCTGGAGATGC TGGAAAAGGAACCCTTTGCCTGTGGCGATCTGGAGTCGCAGGTGAAGACC GCTCTGCTGGACCTAACGGCCAAGGGATTCATACGCTTCATTACCAATGG ATACCGCACCCTGGGACCCATCGCCAAGCTATCCAATGCCCGTTCCGCGC GTCACTTCAACATGACATGGCAGCGCATTGCCGAGCTGCAGAAGGTCAAC TGTCCGAGCCTGGAGGCGGGATCCATCTCCAGCGGACCCTGCATACAGCG CGGAGCCAACTACTAAATGATTTCACTTTTTGTTGTGTTAACCATTTCGT TTATTGAGTTCAGTTCCTTGCAGATCAGCAGAGTAACGCGCCACACACAC TCTCCACACTTCTTCCAAATTGTAATCGTCTAGTAAAATTCCTACAAATC CAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG3687-RA | 712 | CG3687-RA | 58..710 | 1..653 | 3130 | 98.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 12124094..12124353 | 1..260 | 98 | -> | Plus |
chr2R | 12124411..12124801 | 261..651 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3687-RA | 1..432 | 85..516 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3687-RA | 1..432 | 85..516 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3687-RA | 1..432 | 85..516 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3687-RA | 1..432 | 85..516 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3687-RA | 1..432 | 85..516 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3687-RA | 1..651 | 1..651 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3687-RA | 1..651 | 1..651 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3687-RA | 58..708 | 1..651 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3687-RA | 1..651 | 1..651 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG3687-RA | 58..708 | 1..651 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16237089..16237479 | 261..651 | 98 | Plus | |
2R | 16236772..16237031 | 1..260 | 98 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16237089..16237479 | 261..651 | 98 | Plus | |
2R | 16236772..16237031 | 1..260 | 98 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16237089..16237479 | 261..651 | 98 | Plus | |
2R | 16236772..16237031 | 1..260 | 98 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 12124277..12124536 | 1..260 | 98 | -> | Plus |
arm_2R | 12124594..12124984 | 261..651 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16238288..16238678 | 261..651 | 98 | Plus | |
2R | 16237971..16238230 | 1..260 | 98 | -> | Plus |
Translation from 84 to 515
> AT22273.pep MCDEGSIRECEPTTLRLPFNSYHINLPLYILDMVRIFQDHPKYSNGIHEE HILEMLEKEPFACGDLESQVKTALLDLTAKGFIRFITNGYRTLGPIAKLS NARSARHFNMTWQRIAELQKVNCPSLEAGSISSGPCIQRGANY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12275-PA | 138 | GF12275-PA | 1..138 | 1..139 | 670 | 87.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20584-PA | 143 | GG20584-PA | 1..143 | 1..143 | 743 | 95.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20845-PA | 147 | GH20845-PA | 1..147 | 1..143 | 496 | 62.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG3687-PA | 143 | CG3687-PA | 1..143 | 1..143 | 761 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20949-PA | 146 | GI20949-PA | 1..145 | 1..142 | 542 | 69 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10511-PA | 143 | GL10511-PA | 1..142 | 1..142 | 547 | 69.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17611-PA | 143 | GA17611-PA | 1..142 | 1..142 | 547 | 69.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21675-PA | 143 | GM21675-PA | 1..143 | 1..143 | 746 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15433-PA | 143 | GD15433-PA | 1..143 | 1..143 | 754 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20671-PA | 146 | GJ20671-PA | 1..145 | 1..142 | 541 | 71 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20631-PA | 136 | GK20631-PA | 1..135 | 1..136 | 591 | 80.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11770-PA | 143 | GE11770-PA | 1..143 | 1..143 | 750 | 95.8 | Plus |
Translation from 84 to 515
> AT22273.hyp MCDEGSIRECEPTTLRLPFNSYHINLPLYILDMVRIFQDHPKYSNGIHEE HILEMLEKEPFACGDLESQVKTALLDLTAKGFIRFITNGYRTLGPIAKLS NARSARHFNMTWQRIAELQKVNCPSLEAGSISSGPCIQRGANY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG3687-PA | 143 | CG3687-PA | 1..143 | 1..143 | 761 | 100 | Plus |