Clone AT22273 Report

Search the DGRC for AT22273

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:222
Well:73
Vector:pOTB7
Associated Gene/TranscriptCG3687-RA
Protein status:AT22273.pep: gold
Preliminary Size:771
Sequenced Size:670

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3687 2002-01-01 Sim4 clustering to Release 2
CG3687 2002-01-03 Blastp of sequenced clone
CG3687 2003-01-01 Sim4 clustering to Release 3
CG3687 2008-04-29 Release 5.5 accounting
CG3687 2008-08-15 Release 5.9 accounting
CG3687 2008-12-18 5.12 accounting

Clone Sequence Records

AT22273.complete Sequence

670 bp (670 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075261

> AT22273.complete
GCTTCGCTTAGCCTGTCTCTCGGAATAGTATTCATCTAACAAGTATTCAT
CGAACAAAGAAATCGTATTTTTATAAGCTAAGAAATGTGTGACGAAGGAT
CGATCAGGGAATGTGAGCCCACCACCTTGCGGCTTCCTTTCAACAGCTAC
CACATCAATTTGCCGCTATATATTTTGGACATGGTGCGCATCTTCCAGGA
TCATCCCAAGTACAGCAATGGTATCCACGAGGAGCACATTCTGGAGATGC
TGGAAAAGGAACCCTTTGCCTGTGGCGATCTGGAGTCGCAGGTGAAGACC
GCTCTGCTGGACCTAACGGCCAAGGGATTCATACGCTTCATTACCAATGG
ATACCGCACCCTGGGACCCATCGCCAAGCTATCCAATGCCCGTTCCGCGC
GTCACTTCAACATGACATGGCAGCGCATTGCCGAGCTGCAGAAGGTCAAC
TGTCCGAGCCTGGAGGCGGGATCCATCTCCAGCGGACCCTGCATACAGCG
CGGAGCCAACTACTAAATGATTTCACTTTTTGTTGTGTTAACCATTTCGT
TTATTGAGTTCAGTTCCTTGCAGATCAGCAGAGTAACGCGCCACACACAC
TCTCCACACTTCTTCCAAATTGTAATCGTCTAGTAAAATTCCTACAAATC
CAAAAAAAAAAAAAAAAAAA

AT22273.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG3687-RA 712 CG3687-RA 58..710 1..653 3130 98.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12124411..12124801 261..651 1865 98.5 Plus
chr2R 21145070 chr2R 12124094..12124353 1..260 1255 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:56:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16237089..16237481 261..653 1875 98.5 Plus
2R 25286936 2R 16236772..16237031 1..260 1255 98.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16238288..16238680 261..653 1875 98.4 Plus
2R 25260384 2R 16237971..16238230 1..260 1255 98.8 Plus
Blast to na_te.dros performed on 2019-03-16 08:48:13 has no hits.

AT22273.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:49:09 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12124094..12124353 1..260 98 -> Plus
chr2R 12124411..12124801 261..651 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:17:42 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
CG3687-RA 1..432 85..516 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:10 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
CG3687-RA 1..432 85..516 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:54:02 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
CG3687-RA 1..432 85..516 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:43 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
CG3687-RA 1..432 85..516 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:51:19 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
CG3687-RA 1..432 85..516 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:24 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
CG3687-RA 1..651 1..651 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:09 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
CG3687-RA 1..651 1..651 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:54:02 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
CG3687-RA 58..708 1..651 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:43 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
CG3687-RA 1..651 1..651 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:51:19 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
CG3687-RA 58..708 1..651 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:49:09 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16237089..16237479 261..651 98   Plus
2R 16236772..16237031 1..260 98 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:49:09 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16237089..16237479 261..651 98   Plus
2R 16236772..16237031 1..260 98 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:49:09 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16237089..16237479 261..651 98   Plus
2R 16236772..16237031 1..260 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:54:02 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12124277..12124536 1..260 98 -> Plus
arm_2R 12124594..12124984 261..651 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:34 Download gff for AT22273.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16238288..16238678 261..651 98   Plus
2R 16237971..16238230 1..260 98 -> Plus

AT22273.pep Sequence

Translation from 84 to 515

> AT22273.pep
MCDEGSIRECEPTTLRLPFNSYHINLPLYILDMVRIFQDHPKYSNGIHEE
HILEMLEKEPFACGDLESQVKTALLDLTAKGFIRFITNGYRTLGPIAKLS
NARSARHFNMTWQRIAELQKVNCPSLEAGSISSGPCIQRGANY*

AT22273.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12275-PA 138 GF12275-PA 1..138 1..139 670 87.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20584-PA 143 GG20584-PA 1..143 1..143 743 95.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20845-PA 147 GH20845-PA 1..147 1..143 496 62.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG3687-PA 143 CG3687-PA 1..143 1..143 761 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20949-PA 146 GI20949-PA 1..145 1..142 542 69 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10511-PA 143 GL10511-PA 1..142 1..142 547 69.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17611-PA 143 GA17611-PA 1..142 1..142 547 69.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21675-PA 143 GM21675-PA 1..143 1..143 746 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15433-PA 143 GD15433-PA 1..143 1..143 754 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20671-PA 146 GJ20671-PA 1..145 1..142 541 71 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20631-PA 136 GK20631-PA 1..135 1..136 591 80.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11770-PA 143 GE11770-PA 1..143 1..143 750 95.8 Plus

AT22273.hyp Sequence

Translation from 84 to 515

> AT22273.hyp
MCDEGSIRECEPTTLRLPFNSYHINLPLYILDMVRIFQDHPKYSNGIHEE
HILEMLEKEPFACGDLESQVKTALLDLTAKGFIRFITNGYRTLGPIAKLS
NARSARHFNMTWQRIAELQKVNCPSLEAGSISSGPCIQRGANY*

AT22273.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG3687-PA 143 CG3687-PA 1..143 1..143 761 100 Plus