Clone AT22380 Report

Search the DGRC for AT22380

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:223
Well:80
Vector:pOTB7
Associated Gene/TranscriptCG8517-RA
Protein status:AT22380.pep: gold
Preliminary Size:703
Sequenced Size:741

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8517 2002-01-01 Sim4 clustering to Release 2
CG8517 2002-06-10 Blastp of sequenced clone
CG8517 2003-01-01 Sim4 clustering to Release 3
CG8517 2008-04-29 Release 5.5 accounting
CG8517 2008-08-15 Release 5.9 accounting
CG8517 2008-12-18 5.12 accounting

Clone Sequence Records

AT22380.complete Sequence

741 bp (741 high quality bases) assembled on 2002-06-10

GenBank Submission: AY070811

> AT22380.complete
GTCATCACACTGTAGTCCCAAAAATTTTCGGATCAAAATTTTCTTGATAT
TTATCTAGGCTAAAATTTAAGTTATCCGTAAGCTTTATTATGTCCAGCTA
TAGAAGATTATTCCGGGCAAAGCGCCTAATGAATTTGATGAAGGCTAATC
GCGGAATGACCAGTACTGGCAAGCAACCGATTTTCGATGTGGAGACTAGA
AAAGACTTTGAGCAACGTGTGATCAATAGCGATCGGCCGGTGGTTGTGGA
CTTTCATGCCAGCTGGTGCTGTCCATGCAAGGCTCTGGCCCCTCGACTGG
AGAACGTTGTGTCCGAGCAGGAAGGTCGAGTGAGATTGGCCCGGGTCGAT
ATTGATGAGCATGGGGAACTGGCCCTTGACTACAACGTGGGGTCCGTTCC
TTCACTGGTGGTCATCAGCAACGGCAAGGTGGTAAATCGAATGGTTGGCC
TGCAGACCAGCGAATACCTACGCAAGTGGCTCCATAAGGCGGTGCCACAC
CCACCACCTGAGGATACGGAAAACTAGATCAGCATGTCACTAGGGGAGTC
TTATTAAACCACGTTCTCAGCAACACGTTTTTAATTAATTTTCGATTTAA
CAAGTTTCTTAGGTGCATACACTCAAAGAAATAAGGAACCAAGTATGTAG
ATTATAACTATATACCATATTTTGGGAAGAACTTGTACTATTTAAATTTC
GAATATAAAGAAAAGTAAAACTTAAAAAAAAAAAAAAAAAA

AT22380.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG8517-RA 777 CG8517-RA 40..767 1..728 3640 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15601611..15602074 260..723 2320 100 Plus
chr2R 21145070 chr2R 15601291..15601552 1..262 1310 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:56:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19714405..19714873 260..728 2345 100 Plus
2R 25286936 2R 19714085..19714346 1..262 1310 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19715604..19716072 260..728 2345 100 Plus
2R 25260384 2R 19715284..19715545 1..262 1310 100 Plus
Blast to na_te.dros performed on 2019-03-15 12:17:32 has no hits.

AT22380.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:18:27 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15601291..15601552 1..262 100 -> Plus
chr2R 15601614..15602074 263..723 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:17:45 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8517-RA 1..438 90..527 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:25:16 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8517-RA 1..438 90..527 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:40:29 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8517-RA 1..438 90..527 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:47 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8517-RA 1..438 90..527 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:57:02 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8517-RA 1..438 90..527 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:53:02 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8517-RA 10..732 1..723 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:25:15 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8517-RA 10..732 1..723 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:40:29 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8517-RA 10..732 1..723 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:47 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8517-RA 10..732 1..723 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:57:02 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8517-RA 10..732 1..723 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:18:27 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19714085..19714346 1..262 100 -> Plus
2R 19714408..19714868 263..723 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:18:27 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19714085..19714346 1..262 100 -> Plus
2R 19714408..19714868 263..723 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:18:27 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19714085..19714346 1..262 100 -> Plus
2R 19714408..19714868 263..723 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:40:29 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15601590..15601851 1..262 100 -> Plus
arm_2R 15601913..15602373 263..723 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:57 Download gff for AT22380.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19715284..19715545 1..262 100 -> Plus
2R 19715607..19716067 263..723 100   Plus

AT22380.pep Sequence

Translation from 89 to 526

> AT22380.pep
MSSYRRLFRAKRLMNLMKANRGMTSTGKQPIFDVETRKDFEQRVINSDRP
VVVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHGELALDYNV
GSVPSLVVISNGKVVNRMVGLQTSEYLRKWLHKAVPHPPPEDTEN*

AT22380.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11737-PA 138 GF11737-PA 1..135 1..137 575 78.6 Plus
Dana\GF24914-PA 143 GF24914-PA 27..140 24..137 363 55.3 Plus
Dana\TrxT-PA 177 GF20950-PA 2..113 31..138 203 33.9 Plus
Dana\GF21263-PA 162 GF21263-PA 55..141 34..121 198 38.6 Plus
Dana\Trx-2-PA 106 GF22780-PA 2..96 31..124 182 33.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21998-PA 145 GG21998-PA 1..145 1..145 764 97.9 Plus
Dere\GG14861-PA 142 GG14861-PA 14..140 11..137 324 51.2 Plus
Dere\GG12702-PA 159 GG12702-PA 52..138 34..121 197 38.6 Plus
Dere\TrxT-PA 149 GG18503-PA 2..110 31..139 192 33.6 Plus
Dere\Trx-2-PA 106 GG10043-PA 2..92 31..120 167 28.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23019-PA 153 GH23019-PA 22..147 16..141 424 62.7 Plus
Dgri\GH16478-PA 140 GH16478-PA 16..137 17..137 353 52.5 Plus
Dgri\GH12588-PA 161 GH12588-PA 51..152 31..133 199 34 Plus
Dgri\Trx-2-PA 106 GH10676-PA 2..92 31..120 183 33 Plus
Dgri\TrxT-PA 166 GH24365-PA 5..104 34..133 180 31.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG8517-PA 145 CG8517-PA 1..145 1..145 761 100 Plus
CG8993-PA 142 CG8993-PA 14..138 11..135 347 52 Plus
TrxT-PB 157 CG3315-PB 2..104 31..133 201 36.5 Plus
TrxT-PA 157 CG3315-PA 2..104 31..133 201 36.5 Plus
CG3719-PA 160 CG3719-PA 53..151 34..133 195 35 Plus
CG13473-PA 139 CG13473-PA 5..99 28..120 170 31.6 Plus
Trx-2-PA 106 CG31884-PA 2..92 31..120 167 33 Plus
Trx-2-PB 106 CG31884-PB 2..92 31..120 167 33 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21084-PA 144 GI21084-PA 1..138 1..141 343 45.4 Plus
Dmoj\TrxT-PA 165 GI11058-PA 5..106 34..135 213 37.9 Plus
Dmoj\Trx-2-PA 106 GI11084-PA 2..92 31..120 196 37.4 Plus
Dmoj\GI11498-PA 162 GI11498-PA 12..116 29..133 169 32.1 Plus
Dmoj\dhd-PA 106 GI11071-PA 9..103 39..133 161 35.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24652-PA 143 GL24652-PA 27..138 24..135 357 55.4 Plus
Dper\TrxT-PA 167 GL14330-PA 2..106 31..135 219 38.7 Plus
Dper\GL24554-PA 141 GL24554-PA 2..98 25..120 197 33 Plus
Dper\GL14382-PA 161 GL14382-PA 54..140 34..121 192 37.5 Plus
Dper\GL25779-PA 493 GL25779-PA 28..136 34..142 148 33.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21460-PA 143 GA21460-PA 14..138 5..135 358 50.4 Plus
Dpse\TrxT-PA 167 GA17324-PA 2..106 31..135 216 37.7 Plus
Dpse\GA12311-PA 141 GA12311-PA 2..98 25..120 197 33 Plus
Dpse\GA17639-PA 161 GA17639-PA 54..140 34..121 192 37.5 Plus
Dpse\Trx-2-PA 106 GA16546-PA 2..92 31..120 182 33 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21982-PA 145 GM21982-PA 1..145 1..145 766 99.3 Plus
Dsec\GM23203-PA 145 GM23203-PA 1..145 1..145 766 99.3 Plus
Dsec\GM14486-PA 142 GM14486-PA 28..140 25..137 322 55.8 Plus
Dsec\TrxT-PA 172 GM12651-PA 2..115 31..142 194 34.8 Plus
Dsec\Trx-2-PA 106 GM17580-PA 2..92 31..120 175 33 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11480-PA 145 GD11480-PA 1..145 1..145 766 99.3 Plus
Dsim\GD13682-PA 142 GD13682-PA 28..140 25..137 322 55.8 Plus
Dsim\GD16424-PA 159 GD16424-PA 52..138 34..121 197 38.6 Plus
Dsim\GD14500-PA 139 GD14500-PA 5..99 28..120 176 31.6 Plus
Dsim\Trx-2-PA 106 GD23618-PA 2..92 31..120 175 33 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20933-PA 105 GJ20933-PA 2..104 38..140 393 68 Plus
Dvir\GJ13429-PA 141 GJ13429-PA 29..138 28..137 357 56.4 Plus
Dvir\TrxT-PA 163 GJ16575-PA 5..106 34..135 213 37.9 Plus
Dvir\GJ15909-PA 161 GJ15909-PA 54..152 34..133 204 36 Plus
Dvir\Trx-2-PA 106 GJ18315-PA 2..92 31..120 192 36.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15891-PA 145 GK15891-PA 30..136 29..135 468 76.6 Plus
Dwil\GK12639-PA 141 GK12639-PA 26..138 25..137 359 54.9 Plus
Dwil\TrxT-PA 174 GK25104-PA 2..106 31..135 204 34 Plus
Dwil\GK16685-PA 161 GK16685-PA 54..140 34..121 200 38.6 Plus
Dwil\GK10532-PA 176 GK10532-PA 6..116 27..138 182 31.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12078-PA 145 GE12078-PA 1..145 1..145 762 97.9 Plus
Dyak\GE20317-PA 142 GE20317-PA 13..140 10..137 323 50.8 Plus
Dyak\GE16531-PA 159 GE16531-PA 52..138 34..121 201 39.8 Plus
Dyak\TrxT-PA 157 GE16820-PA 2..104 31..133 188 35.6 Plus
Dyak\GE22025-PA 132 GE22025-PA 2..99 26..120 166 32.7 Plus

AT22380.hyp Sequence

Translation from 89 to 526

> AT22380.hyp
MSSYRRLFRAKRLMNLMKANRGMTSTGKQPIFDVETRKDFEQRVINSDRP
VVVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHGELALDYNV
GSVPSLVVISNGKVVNRMVGLQTSEYLRKWLHKAVPHPPPEDTEN*

AT22380.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG8517-PA 145 CG8517-PA 1..145 1..145 761 100 Plus
CG8993-PA 142 CG8993-PA 14..138 11..135 347 52 Plus
TrxT-PB 157 CG3315-PB 2..104 31..133 201 36.5 Plus
TrxT-PA 157 CG3315-PA 2..104 31..133 201 36.5 Plus
CG3719-PA 160 CG3719-PA 53..151 34..133 195 35 Plus