Clone AT22559 Report

Search the DGRC for AT22559

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:225
Well:59
Vector:pOTB7
Associated Gene/TranscriptCG31802-RA
Protein status:AT22559.pep: gold
Preliminary Size:1437
Sequenced Size:820

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15158 2002-01-01 Sim4 clustering to Release 2
CG31802 2002-01-18 Blastp of sequenced clone
CG31802 2003-01-01 Sim4 clustering to Release 3
CG31802 2008-04-29 Release 5.5 accounting
CG31802 2008-08-15 Release 5.9 accounting
CG31802 2008-12-18 5.12 accounting

Clone Sequence Records

AT22559.complete Sequence

820 bp (820 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089399

> AT22559.complete
CTCAAACAATCGATATTCCTACCGACTCCCACATCAAAAAGCCGATAAGA
TCATCATGTCCGGCAAACGACTTGGTAGTATGGTGTCCTCCGCCAGTGTA
ATGCATTCGAGTGCATCGATCTCAAGCAGGGCTAAAAAATCGAAAAAGCC
CAAACTGCCGACCTTTGACCTGTCGCTAAGCCAGAAGGTGGACATTAAGA
AAGCCTTCGATTTGTTCGACACCCAGTGCACGGGCTTTATCGAAACCAAG
GAGCTTCGCGTGGCCATTCGTGCCCTGGGATTCGAGCCGAAGAAAGAGGA
TATAAAGCGTATGATGGACGAAATCGATAAGGACAAGACGGGAAGGATTG
CCTTTAACGATTTTCTATATCTGATGCGCCTGAAGATGGCGGAAAAGGAC
TCTAATCAGGATATGATGAAGGCCTTTTCCTTCTTCGATGACGATCGCAC
CGGCGGCATATCCTTCCTCAACTTGAAACGCGTGGCCAAGGAGCTGGGCG
AACAGCTCACCGACGAGGAACTGCAGGAGATGATCGACGAAGCCAACGTT
TCCGGTGATGGTGAGGTTAGCAAGGAGGAGTTTCTCAACCTTATCAAGAA
AACCAATCTCATCTAGTTGCATTACGTTTAAATTTATTCCGCAATTCATT
TGTGTAAACGGGAAACGACGTTGTATATAACCCATATAGATTTACTCATT
TTTCAGACAGACACATCAATCTGACTCGAAACCCATTACAGTGAAGAAGT
TTGGATATGCTTCGGTTCAATAAAGCTTCGCATTGAATTAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAA

AT22559.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG31802-RA 824 CG31802-RA 35..824 1..790 3950 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18207085..18207873 789..1 3945 100 Minus
chr2L 23010047 chr2L 22441922..22442136 191..405 190 72.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:56:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:48:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18208414..18209203 790..1 3950 100 Minus
2L 23513712 2L 22550682..22550896 191..405 190 72.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18208414..18209203 790..1 3950 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:48:23 has no hits.

AT22559.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:49:10 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18207085..18207873 1..789 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:17:50 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
CG31802-RA 1..561 56..616 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:46:49 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
CG31802-RA 1..561 56..616 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:54:34 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
CG31802-RA 1..561 56..616 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:14:55 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
CG31802-RA 1..561 56..616 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:54:19 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
CG31802-RA 1..561 56..616 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:11:02 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
CG31802-RA 35..823 1..789 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:46:49 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
CG31802-RA 35..823 1..789 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:54:34 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
CG31802-RA 35..823 1..789 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:14:56 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
CG31802-RA 35..823 1..789 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:54:19 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
CG31802-RA 35..823 1..789 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:49:10 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18208415..18209203 1..789 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:49:10 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18208415..18209203 1..789 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:49:10 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18208415..18209203 1..789 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:54:34 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18208415..18209203 1..789 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:48:39 Download gff for AT22559.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18208415..18209203 1..789 100   Minus

AT22559.hyp Sequence

Translation from 1 to 615

> AT22559.hyp
SNNRYSYRLPHQKADKIIMSGKRLGSMVSSASVMHSSASISSRAKKSKKP
KLPTFDLSLSQKVDIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKED
IKRMMDEIDKDKTGRIAFNDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRT
GGISFLNLKRVAKELGEQLTDEELQEMIDEANVSGDGEVSKEEFLNLIKK
TNLI*

AT22559.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG31802-PA 186 CG31802-PA 1..186 19..204 925 100 Plus
CG17493-PD 182 CG17493-PD 23..181 45..203 544 66.7 Plus
CG17493-PC 182 CG17493-PC 23..181 45..203 544 66.7 Plus
CG17493-PB 182 CG17493-PB 23..181 45..203 544 66.7 Plus
Cam-PD 149 CG8472-PD 5..146 57..198 303 43.7 Plus

AT22559.pep Sequence

Translation from 55 to 615

> AT22559.pep
MSGKRLGSMVSSASVMHSSASISSRAKKSKKPKLPTFDLSLSQKVDIKKA
FDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRMMDEIDKDKTGRIAF
NDFLYLMRLKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQ
LTDEELQEMIDEANVSGDGEVSKEEFLNLIKKTNLI*

AT22559.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:21:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22746-PA 184 GF22746-PA 1..183 1..185 586 62.2 Plus
Dana\GF19690-PA 101 GF19690-PA 1..101 86..186 453 88.1 Plus
Dana\GF12835-PA 149 GF12835-PA 5..146 39..180 292 43.7 Plus
Dana\GF16772-PA 148 GF16772-PA 3..147 38..182 280 43.4 Plus
Dana\GF13647-PA 148 GF13647-PA 3..145 38..180 220 34.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21714-PA 186 GG21714-PA 1..186 1..186 852 96.2 Plus
Dere\GG21382-PA 182 GG21382-PA 4..181 10..185 554 61.2 Plus
Dere\GG20265-PA 149 GG20265-PA 5..146 39..180 292 43.7 Plus
Dere\GG11425-PA 148 GG11425-PA 3..147 38..182 242 37.9 Plus
Dere\GG11424-PA 164 GG11424-PA 17..164 36..183 240 33.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23794-PA 186 GH23794-PA 3..186 4..186 683 74.5 Plus
Dgri\GH10538-PA 186 GH10538-PA 3..186 4..186 683 74.5 Plus
Dgri\GH10976-PA 190 GH10976-PA 7..189 7..185 584 61.7 Plus
Dgri\GH23405-PA 151 GH23405-PA 4..150 36..182 251 38.1 Plus
Dgri\GH16402-PA 155 GH16402-PA 7..152 38..180 195 33.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG31802-PA 186 CG31802-PA 1..186 1..186 925 100 Plus
CG17493-PD 182 CG17493-PD 23..181 27..185 544 66.7 Plus
CG17493-PC 182 CG17493-PC 23..181 27..185 544 66.7 Plus
CG17493-PB 182 CG17493-PB 23..181 27..185 544 66.7 Plus
Cam-PD 149 CG8472-PD 5..146 39..180 303 43.7 Plus
Cam-PC 149 CG8472-PC 5..146 39..180 303 43.7 Plus
Cam-PE 149 CG8472-PE 5..146 39..180 303 43.7 Plus
Cam-PB 149 CG8472-PB 5..146 39..180 303 43.7 Plus
Cam-PA 149 CG8472-PA 5..146 39..180 303 43.7 Plus
Acam-PB 148 CG17769-PB 3..147 38..182 258 37.9 Plus
Acam-PA 148 CG17769-PA 3..147 38..182 258 37.9 Plus
CG31960-PA 148 CG31960-PA 3..145 38..180 247 35.7 Plus
azot-PA 148 CG11165-PA 3..145 38..180 239 35 Plus
TpnC73F-PC 155 CG7930-PC 7..152 38..180 228 34.2 Plus
TpnC73F-PA 155 CG7930-PA 7..152 38..180 228 34.2 Plus
TpnC47D-PB 155 CG9073-PB 7..152 38..180 226 34.2 Plus
TpnC47D-PA 155 CG9073-PA 7..152 38..180 226 34.2 Plus
CG17770-PA 164 CG17770-PA 17..164 36..183 224 31.8 Plus
CG30378-PA 148 CG30378-PA 5..147 39..181 208 28.7 Plus
CG11638-PA 387 CG11638-PA 206..355 39..180 203 31.3 Plus
TpnC25D-PC 149 CG6514-PC 5..146 43..180 200 30.3 Plus
TpnC25D-PA 149 CG6514-PA 5..146 43..180 200 30.3 Plus
CG5024-PB 165 CG5024-PB 18..165 36..183 197 29.1 Plus
CG5024-PA 165 CG5024-PA 18..165 36..183 197 29.1 Plus
TpnC25D-PB 143 CG6514-PB 4..140 47..180 195 29.2 Plus
CG13898-PA 151 CG13898-PA 15..145 46..176 190 32.8 Plus
Mlc-c-PA 147 CG3201-PA 8..144 43..180 187 32.6 Plus
Mlc-c-PB 153 CG3201-PB 17..150 46..180 184 32.6 Plus
TpnC41C-PB 154 CG2981-PB 4..149 38..180 183 27.4 Plus
TpnC41C-PA 154 CG2981-PA 4..149 38..180 183 27.4 Plus
CG13526-PA 154 CG13526-PA 16..150 46..180 181 23 Plus
sqh-PE 174 CG3595-PE 1..165 10..181 162 27.3 Plus
sqh-PD 174 CG3595-PD 1..165 10..181 162 27.3 Plus
sqh-PC 174 CG3595-PC 1..165 10..181 162 27.3 Plus
sqh-PB 174 CG3595-PB 1..165 10..181 162 27.3 Plus
sqh-PA 174 CG3595-PA 1..165 10..181 162 27.3 Plus
CG33098-PD 164 CG33098-PD 11..132 38..163 161 29.4 Plus
CG33098-PF 230 CG33098-PF 77..198 38..163 161 29.4 Plus
CG33098-PE 230 CG33098-PE 77..198 38..163 161 29.4 Plus
CG33098-PB 230 CG33098-PB 77..198 38..163 161 29.4 Plus
TpnC4-PB 153 CG12408-PB 14..151 47..180 159 26.8 Plus
TpnC4-PA 153 CG12408-PA 14..151 47..180 159 26.8 Plus
Eip63F-1-PC 181 CG15855-PC 1..180 16..180 154 26.6 Plus
Eip63F-1-PA 193 CG15855-PA 13..192 16..180 154 26.6 Plus
Eip63F-1-PD 166 CG15855-PD 8..165 42..180 145 26.6 Plus
CG33098-PC 199 CG33098-PC 77..170 38..135 144 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20846-PA 184 GI20846-PA 5..184 6..186 706 76.2 Plus
Dmoj\GI17489-PA 205 GI17489-PA 37..204 18..185 537 61.9 Plus
Dmoj\GI20594-PA 149 GI20594-PA 5..146 39..180 292 43.7 Plus
Dmoj\GI10339-PA 149 GI10339-PA 4..148 38..182 254 38.6 Plus
Dmoj\GI10340-PA 150 GI10340-PA 5..147 38..180 232 38.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19433-PA 180 GL19433-PA 1..180 6..186 682 77.3 Plus
Dper\GL26165-PA 192 GL26165-PA 33..191 27..185 573 68.6 Plus
Dper\GL10814-PA 149 GL10814-PA 5..146 39..180 292 43.7 Plus
Dper\GL21535-PA 148 GL21535-PA 3..147 38..182 262 39.3 Plus
Dper\GL21536-PA 148 GL21536-PA 3..147 38..182 257 37.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16488-PA 180 GA16488-PA 1..180 6..186 708 76.8 Plus
Dpse\GA24499-PA 149 GA24499-PA 5..146 39..180 292 43.7 Plus
Dpse\GA14657-PA 148 GA14657-PA 3..147 38..182 262 39.3 Plus
Dpse\GA26322-PA 148 GA26322-PA 3..147 38..182 257 37.9 Plus
Dpse\GA24239-PA 149 GA24239-PA 5..148 38..181 256 38.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17095-PA 186 GM17095-PA 1..186 1..186 953 99.5 Plus
Dsec\GM19287-PA 182 GM19287-PA 5..181 11..185 546 61 Plus
Dsec\GM21351-PA 149 GM21351-PA 5..146 39..180 292 43.7 Plus
Dsec\GM10265-PA 148 GM10265-PA 3..147 38..182 243 37.9 Plus
Dsec\GM20994-PA 148 GM20994-PA 3..145 38..180 229 34.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21839-PA 186 GD21839-PA 1..186 1..186 953 99.5 Plus
Dsim\GD17706-PA 122 GD17706-PA 5..122 11..127 318 55.5 Plus
Dsim\GD10849-PA 149 GD10849-PA 5..146 39..180 292 43.7 Plus
Dsim\GD21235-PA 148 GD21235-PA 3..147 38..182 243 37.9 Plus
Dsim\GD10523-PA 148 GD10523-PA 3..145 38..180 226 32.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19846-PA 184 GJ19846-PA 5..184 6..186 696 76.4 Plus
Dvir\GJ15110-PA 190 GJ15110-PA 30..189 26..185 569 67.5 Plus
Dvir\GJ10193-PA 151 GJ10193-PA 6..150 38..182 254 40 Plus
Dvir\GJ20779-PA 113 GJ20779-PA 1..110 71..180 236 43.6 Plus
Dvir\GJ15117-PA 152 GJ15117-PA 9..152 39..182 218 34 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15343-PA 197 GK15343-PA 37..196 26..185 572 68.8 Plus
Dwil\GK19020-PA 101 GK19020-PA 1..101 86..186 430 83.2 Plus
Dwil\GK11587-PA 159 GK11587-PA 6..159 33..186 360 47.4 Plus
Dwil\GK22183-PA 149 GK22183-PA 5..146 39..180 292 43.7 Plus
Dwil\GK18988-PA 148 GK18988-PA 3..147 38..182 269 40 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12738-PA 186 GE12738-PA 1..186 1..186 926 96.8 Plus
Dyak\GE22671-PA 182 GE22671-PA 4..181 10..185 562 62.9 Plus
Dyak\GE22672-PA 182 GE22672-PA 4..181 10..185 553 62.4 Plus
Dyak\GE15093-PA 249 GE15093-PA 122..238 10..124 330 57.3 Plus
Dyak\Cam-PA 149 GE12425-PA 5..146 39..180 292 43.7 Plus