Clone AT22563 Report

Search the DGRC for AT22563

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:225
Well:63
Vector:pOTB7
Associated Gene/TranscriptCG30100-RA
Protein status:AT22563.pep2: gold AT22563.pep: gold
Sequenced Size:780

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30100 2003-01-01 Sim4 clustering to Release 3
CG30100 2008-04-29 Release 5.5 accounting
CG30100 2008-04-29 Picked prior to 5.5
CG30100 2008-08-15 Release 5.9 accounting
CG42372 2008-12-18 5.12 accounting
CG30100 2008-12-18 5.12 accounting
CG42372 2020-09-28 Sue said so

Clone Sequence Records

AT22563.complete Sequence

780 bp assembled on 2007-07-16

GenBank Submission: BT030757

> AT22563.complete
GCACAACGCCACAGCTGATTGTGTTTGCGCTGAACTGCCAACCTGTTATA
GTTCTGCGTTAACCAGCACTGTCACACATGTGAGAGTGAAATATGAAAAT
GGTTCAACCTTCGCGGCAGCAAATTTTGCGTTTATACAAGCATTTAATTC
GTTACGGCAATCACCTAAAGCTGACTGACAAGAACTACTTTCTGGGAAGA
GTTCGCCACGAGTTTCGGGACAACCGTTCCCTTACGAATCCCGTGGAAGT
GGAATTCAGCTTTAAGCGCGGAGAGACCCTGCTGAAGAAGGGACGCATTC
TGTAGGAATGCTGCGAGGTCTGGTGCGATTCCTGGCGCTGCCTCCGACCG
CTGTGCGCTGCAAGTCGAATCTGGACTACTCCCGCTTTCCCGTGCTTCAG
GAGTCCGATATCGAGGAGACCTTCATGCGGGGCAGTGGTCCTGGTGGCCA
GGCTGTCAACAAGACATCCAACTGCGTGTTCTTGCGCCATCTACCCACCA
ATATAACGGTCAAGTGTCACACACATCGTCTAGCATCAAAGAATCGAGTG
GAGGCTCGTAAACTTCTACTGGAAAAACTGGACGTGCATCTAAACGGGGA
GCATTCAATTGCCGCGCAAGTCAAGGCACAAGAGCAGAGAAAGTCCACTG
AGCGGCGGCGGCGACAGGAAAAGCTGCAAGAAATGAAGAAAAGCTGGCAG
GATAGAGAGCGCACAGATGGGGGAACCAAATCTACCGATAAAGAGTGATA
ACATTTACTTCTAAAAAAAAAAAAAAAAAA

AT22563.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG42372-RA 748 CG42372-RA 1..748 1..748 3590 98.6 Plus
CG30100-RA 748 CG30100-RA 1..748 1..748 3590 98.6 Plus
CG42372-RB 298 CG42372-RB 1..266 1..266 1255 98.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12179121..12179622 261..762 2405 98.6 Plus
chr2R 21145070 chr2R 12178806..12179071 1..266 1255 98.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:56:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16291768..16292273 261..766 2425 98.6 Plus
2R 25286936 2R 16291453..16291718 1..266 1255 98.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16292967..16293472 261..766 2425 98.6 Plus
2R 25260384 2R 16292652..16292917 1..266 1255 98.1 Plus
Blast to na_te.dros performed on 2019-03-16 11:14:33 has no hits.

AT22563.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:15:29 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12178806..12179071 1..266 98 -> Plus
chr2R 12179127..12179622 267..762 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:17:54 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
CG30100-RA 1..441 308..748 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:26:30 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
CG30100-RA 1..441 308..748 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:38:22 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
CG30100-RA 1..441 308..748 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:12:56 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
CG30100-RA 1..441 308..748 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:31:14 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
CG30100-RA 1..441 308..748 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:32:27 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
CG42372-RA 1..748 1..748 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:26:30 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
CG42372-RA 1..762 1..762 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:38:22 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
CG42372-RA 1..762 1..762 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:12:57 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
CG30100-RA 1..748 1..748 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:31:14 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
CG30100-RA 1..762 1..762 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:15:29 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16291453..16291718 1..266 98 -> Plus
2R 16291774..16292269 267..762 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:15:29 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16291453..16291718 1..266 98 -> Plus
2R 16291774..16292269 267..762 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:15:29 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16291453..16291718 1..266 98 -> Plus
2R 16291774..16292269 267..762 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:38:22 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12178958..12179223 1..266 98 -> Plus
arm_2R 12179279..12179774 267..762 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:58:47 Download gff for AT22563.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16292652..16292917 1..266 98 -> Plus
2R 16292973..16293468 267..762 98   Plus

AT22563.pep2 Sequence

Translation from 92 to 304

> AT22563.pep2
MKMVQPSRQQILRLYKHLIRYGNHLKLTDKNYFLGRVRHEFRDNRSLTNP
VEVEFSFKRGETLLKKGRIL*

AT22563.pep2 Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20591-PA 68 GG20591-PA 1..68 3..70 350 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG42372-PA 68 CG42372-PA 1..68 3..70 353 100 Plus
CG42372-PC 68 CG42372-PC 1..68 3..70 353 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:31:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10726-PA 181 GL10726-PA 1..61 3..63 266 80.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:31:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15649-PA 181 GA15649-PA 1..61 3..63 266 80.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21683-PA 68 GM21683-PA 1..68 3..70 350 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:31:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20726-PA 167 GK20726-PA 1..59 3..61 257 79.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:31:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11777-PA 68 GE11777-PA 1..68 3..70 334 97.1 Plus

AT22563.hyp Sequence

Translation from 307 to 747

> AT22563.hyp
MLRGLVRFLALPPTAVRCKSNLDYSRFPVLQESDIEETFMRGSGPGGQAV
NKTSNCVFLRHLPTNITVKCHTHRLASKNRVEARKLLLEKLDVHLNGEHS
IAAQVKAQEQRKSTERRRRQEKLQEMKKSWQDRERTDGGTKSTDKE*

AT22563.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG30100-PB 146 CG30100-PB 1..146 1..146 754 100 Plus
CG30100-PA 146 CG30100-PA 1..146 1..146 754 100 Plus

AT22563.pep Sequence

Translation from 307 to 747

> AT22563.pep
MLRGLVRFLALPPTAVRCKSNLDYSRFPVLQESDIEETFMRGSGPGGQAV
NKTSNCVFLRHLPTNITVKCHTHRLASKNRVEARKLLLEKLDVHLNGEHS
IAAQVKAQEQRKSTERRRRQEKLQEMKKSWQDRERTDGGTKSTDKE*

AT22563.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13589-PA 141 GF13589-PA 12..140 12..138 597 86 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20592-PA 148 GG20592-PA 1..146 1..146 753 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22113-PA 148 GH22113-PA 24..147 20..141 506 75.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG30100-PB 146 CG30100-PB 1..146 1..146 754 100 Plus
CG30100-PA 146 CG30100-PA 1..146 1..146 754 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19248-PA 141 GI19248-PA 4..139 2..137 531 74.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10726-PA 181 GL10726-PA 55..181 16..145 551 80 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15649-PA 181 GA15649-PA 55..181 16..145 546 79.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21684-PA 146 GM21684-PA 1..146 1..146 756 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20369-PA 146 GD20369-PA 1..146 1..146 752 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15534-PA 142 GJ15534-PA 4..139 2..137 510 70.6 Plus
Dvir\GJ20325-PA 142 GJ20325-PA 4..139 2..137 510 70.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20726-PA 167 GK20726-PA 55..162 30..137 500 85.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11778-PA 146 GE11778-PA 1..146 1..146 745 96.6 Plus