Clone AT22714 Report

Search the DGRC for AT22714

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:227
Well:14
Vector:pOTB7
Associated Gene/TranscriptCG30284-RA
Protein status:AT22714.pep: gold
Sequenced Size:1214

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30284 2002-09-13 Blastp of sequenced clone
CG30284 2008-04-29 Release 5.5 accounting
CG30284 2008-08-15 Release 5.9 accounting
CG30284 2008-12-18 5.12 accounting

Clone Sequence Records

AT22714.complete Sequence

1214 bp (1214 high quality bases) assembled on 2002-09-13

GenBank Submission: BT001341

> AT22714.complete
AAAATTCGAGTGATTCGATTTTATGGTGTCATTGACAATGTTTTAATTGA
AGATGACTAAGAACGTTGGCTAGAATATGAAGTCGATTCAGGCCCGGTTG
AACCACCGATTCCGAAAAACTTTGGCGATGGACAAGCCGTCTAGCAGCAA
TAGCAATCGAATGAGCAGGAGCACTTCGAACTGCAGGAGCCCGGCCATAA
TACGCAGTCCGCTGAACTCTGAGGAATTTCAGGACTCGGCAACGGCAGCC
GCCACACAACAACGGCTTTTCTGGAGCGGCCAGCGGGCCTCGACGGCGGG
CAGGGATGATAAAACCAAGCCTGATTCGACTGCCGCCGGAAAAAAGAAGC
CACCTACGACGACAAGGCAGTCAAATTTTACCCAGACCGAACGAAGACGG
ACACATCGCAAGCTGAGTCCGCGGAGCACGCGTTGCAATTCGGTGGCAGT
TACGGCGCTGGTCAGCAGAGAAAATATACCGCAAACATCCGGTAAGCGCG
GAAAAAAAACTCCGAGCCACCGGAGCACACTAATAAGTACTCCATCGAAA
ACACTACAATTAAAAACGGCCGCAGGGTACAGAAGGCCAGAGGACCTAAC
CGCCCGGTGCAGTGCGTCGCACGAGGGGCGCAAGCTTCTGCAGGAGCGGC
TGATGGTGCGGGTGGACGCACTGTTCAACATGCTCTTCTCTGCCTCGCCG
TTCCTGCAGAGCTTCCATGAGCGGCGCAAGTCCACCGATCTGAATATGGG
CGTCTGGGCGCGAAATGCCGGCGGCCAGAATCAGCGCACTGTCTCAATGA
CTGTGGCACTTCAGGCGAACGTTGGTCCCAAAACTGCCAAAATTACCGAG
ACACAGACCATGCGCGAGTGCAGCCAACCCGGCCAACTGTACTCGATCGA
TGTGCAGAGCGTTAACGCAGATATCCCCTACGCGGACACCTTCGTCGTCC
TGATGCACTTCTGCCTGAAGGCCACCGTGGAAGAGCACACGGACGTTTTG
GTCTTTGCCGAGATCCAGTTTCTCAAGTCCGTGTGGGCAGTGGTCAAGAC
CTTTATCGAGAGGAACGCGTACGCGGGTCTCGAGGAGTTCTGTCAATCTC
TATACAGCGCCCTACTGATTGAGATTAGGAAGATGTAGGCGGCCAGAGGG
CTCAAATACACTTCAAAATAGCAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAA

AT22714.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG30284-RA 1175 CG30284-RA 1..1172 1..1172 5860 100 Plus
CG30284-RB 1083 CG30284-RB 478..1075 575..1172 2990 100 Plus
CG30284-RB 1083 CG30284-RB 1..479 14..492 2395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17537276..17538447 1172..1 5830 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:56:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21650828..21651999 1172..1 5860 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21652027..21653198 1172..1 5860 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:22:19 has no hits.

AT22714.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:23:05 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17537276..17538447 1..1172 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:17:55 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30284-RA 1..1062 77..1138 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:15:28 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30284-RA 1..1062 77..1138 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:39:53 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30284-RA 1..1062 77..1138 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:06:24 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30284-RA 1..1062 77..1138 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:31:25 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30284-RA 1..1062 77..1138 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:39:05 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30284-RA 1..1172 1..1172 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:15:28 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30284-RA 1..1172 1..1172 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:39:53 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30284-RA 1..1172 1..1172 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:06:24 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30284-RA 1..1172 1..1172 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:31:25 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
CG30284-RA 1..1172 1..1172 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:23:05 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21650828..21651999 1..1172 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:23:05 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21650828..21651999 1..1172 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:23:05 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21650828..21651999 1..1172 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:39:53 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17538333..17539504 1..1172 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:38:22 Download gff for AT22714.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21652027..21653198 1..1172 100   Minus

AT22714.pep Sequence

Translation from 76 to 1137

> AT22714.pep
MKSIQARLNHRFRKTLAMDKPSSSNSNRMSRSTSNCRSPAIIRSPLNSEE
FQDSATAAATQQRLFWSGQRASTAGRDDKTKPDSTAAGKKKPPTTTRQSN
FTQTERRRTHRKLSPRSTRCNSVAVTALVSRENIPQTSGKRGKKTPSHRS
TLISTPSKTLQLKTAAGYRRPEDLTARCSASHEGRKLLQERLMVRVDALF
NMLFSASPFLQSFHERRKSTDLNMGVWARNAGGQNQRTVSMTVALQANVG
PKTAKITETQTMRECSQPGQLYSIDVQSVNADIPYADTFVVLMHFCLKAT
VEEHTDVLVFAEIQFLKSVWAVVKTFIERNAYAGLEEFCQSLYSALLIEI
RKM*

AT22714.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:07:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11633-PA 381 GF11633-PA 1..381 1..353 815 47.2 Plus
Dana\GF15685-PA 1293 GF15685-PA 747..921 175..349 580 59.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:07:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20760-PA 325 GG20760-PA 1..324 1..352 1394 77.3 Plus
Dere\GG24446-PA 1235 GG24446-PA 729..900 175..346 556 56.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10472-PA 1099 GH10472-PA 613..784 175..346 571 57.6 Plus
Dgri\GH23042-PA 258 GH23042-PA 77..255 177..353 508 52 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG30284-PA 353 CG30284-PA 1..353 1..353 1794 100 Plus
CG30284-PB 325 CG30284-PB 1..325 1..353 1616 92.1 Plus
GramD1B-PG 804 CG34394-PG 126..469 19..349 525 35.4 Plus
GramD1B-PA 1138 CG34394-PA 561..904 19..349 525 35.4 Plus
GramD1B-PH 1206 CG34394-PH 537..880 19..349 525 35.4 Plus
GramD1B-PD 1212 CG34394-PD 635..978 19..349 525 35.4 Plus
GramD1B-PC 1239 CG34394-PC 561..904 19..349 525 35.4 Plus
GramD1B-PE 1249 CG34394-PE 571..914 19..349 525 35.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21111-PA 187 GI21111-PA 11..183 175..346 511 53.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19523-PA 1043 GL19523-PA 733..907 175..349 543 53.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15750-PA 247 GA15750-PA 61..236 178..352 646 63.6 Plus
Dpse\GA25994-PA 1173 GA25994-PA 761..932 175..346 540 54.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15703-PA 326 GM15703-PA 1..325 1..352 1581 85.6 Plus
Dsec\GM18152-PA 1234 GM18152-PA 727..898 175..346 545 55.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25181-PA 326 GD25181-PA 1..325 1..352 1539 86.4 Plus
Dsim\GD22763-PA 1203 GD22763-PA 727..898 175..346 545 55.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10381-PA 1187 GJ10381-PA 699..873 175..349 584 59.4 Plus
Dvir\GJ20960-PA 203 GJ20960-PA 24..199 178..352 545 53.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19339-PA 306 GK19339-PA 62..300 106..350 617 49.4 Plus
Dwil\GK18353-PA 1207 GK18353-PA 708..882 175..349 575 57.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:07:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13691-PA 332 GE13691-PA 1..331 1..352 1343 72.7 Plus
Dyak\GE14894-PA 1236 GE14894-PA 728..899 175..346 549 55.8 Plus

AT22714.hyp Sequence

Translation from 76 to 1137

> AT22714.hyp
MKSIQARLNHRFRKTLAMDKPSSSNSNRMSRSTSNCRSPAIIRSPLNSEE
FQDSATAAATQQRLFWSGQRASTAGRDDKTKPDSTAAGKKKPPTTTRQSN
FTQTERRRTHRKLSPRSTRCNSVAVTALVSRENIPQTSGKRGKKTPSHRS
TLISTPSKTLQLKTAAGYRRPEDLTARCSASHEGRKLLQERLMVRVDALF
NMLFSASPFLQSFHERRKSTDLNMGVWARNAGGQNQRTVSMTVALQANVG
PKTAKITETQTMRECSQPGQLYSIDVQSVNADIPYADTFVVLMHFCLKAT
VEEHTDVLVFAEIQFLKSVWAVVKTFIERNAYAGLEEFCQSLYSALLIEI
RKM*

AT22714.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG30284-PA 353 CG30284-PA 1..353 1..353 1794 100 Plus
CG30284-PB 325 CG30284-PB 1..325 1..353 1616 92.1 Plus
CG34394-PG 804 CG34394-PG 126..469 19..349 525 35.4 Plus
CG34394-PA 1138 CG34394-PA 561..904 19..349 525 35.4 Plus
CG34394-PH 1206 CG34394-PH 537..880 19..349 525 35.4 Plus