Clone AT22731 Report

Search the DGRC for AT22731

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:227
Well:31
Vector:pOTB7
Associated Gene/TranscriptSIP3-RA
Protein status:AT22731.pep: gold
Preliminary Size:1041
Sequenced Size:1090

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15468 2002-01-01 Sim4 clustering to Release 2
CG15468 2002-01-18 Blastp of sequenced clone
CG15468 2003-01-01 Sim4 clustering to Release 3
SIP3 2008-04-29 Release 5.5 accounting
SIP3 2008-08-15 Release 5.9 accounting
SIP3 2008-12-18 5.12 accounting

Clone Sequence Records

AT22731.complete Sequence

1090 bp (1090 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089400

> AT22731.complete
GCGCGATCTGGGCGACTGTCACAAGGCGAATCTGGCGGACATCGATATCA
TAGCGCGAACGACCACCAAATGTCAGTTGGGAGGAGAGCAGATGATTTCG
CCAGGCTATCAGAGGTTAGGCCCTTCCTTGGATCGAGTACCAGATGATGA
GGAAACCGACTCACAGGAGGAGGAGATGGAAATACTGCCATGCGGAATGG
GCGAGGAGGGCATAACCACCGATGAGGAGACAAAAACCCTGATTACCATT
CAGGGTCTGGACGAGATATTGAAAAGAATCGATATATTGCGTAGTCAACT
CCGCAGGAATCAGCAATTGGAGGATATTAGCCAACCATCGGTAATGCCAG
AGGATCCGATCTCCTGCAGTGGCCTGAATGCGAAGCAATCGGAGATACGG
TGCATTCAACGTGCCCAGCATCACATTCAGTGCCAACTAACCGAACTCCT
GTGCCGCTACGATGCCCTCCGGAATATGTTGCGCAGTTTGGGCGAAACGT
GGACGTGTCTAGAGCGACGAATTGCCGATATTCGGGGACAGAACCGCGTC
CACTTGGCCTGGACTGAGGAGTGCGCCAACGATCTAAGCAACTGCCAGCA
GAGACATCGCTCCTTGGCCGCCGTCAAGCTTACCAAAAAGATGGCCCTGC
TCGTGACCAAAACGAATATGTCCAGTGGCTTTCGCTATAGCCGTCGATAT
CTACGACATGCCCTGATCGCTCGACATATCAACGACTTTCGCTACGAGAT
CGCCGAGTTGAAGGTTTTAAGCGAGGAAATTTTCTCCGAAATCGATGGGC
GACTGGACCAGATCAAGATGAAGGCTCAACGATTCGGAGTCGTATTCTCG
ACCACGCCGCGTCAATCCAATCTAATCGCCGATGGAACTGGCAACACTGA
GCTAACCGAGCTAACTGATGCCACCGAAACGTTCACCGTTCCAAGGAGCA
ATAATCCAAAATAACAATTTCAAGGGCACATAGAGAAAGCACATTATCAT
TAGGAAATAAAATAGGAAAATCATTAAGTTATAATAAGAGCAAAGAAAAA
TAAATACAAAAATGTAAAATGCAAAAAAAAAAAAAAAAAA

AT22731.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
SIP3-RA 1075 SIP3-RA 1..1075 1..1075 5375 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4852691..4853762 1072..1 5360 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:56:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4959926..4961000 1075..1 5375 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4968024..4969098 1075..1 5375 100 Minus
Blast to na_te.dros performed on 2019-03-16 08:48:44 has no hits.

AT22731.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:49:25 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4852691..4853762 1..1072 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:17:57 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
SIP3-RA 1..873 92..964 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:40 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
SIP3-RA 1..873 92..964 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:54:14 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
SIP3-RA 1..873 92..964 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:12 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
SIP3-RA 1..873 92..964 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:51:52 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
SIP3-RA 1..873 92..964 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:07:39 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
SIP3-RA 1..1072 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:40 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
SIP3-RA 1..1072 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:54:14 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
SIP3-RA 129..1200 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:13 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
SIP3-RA 1..1072 1..1072 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:51:52 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
SIP3-RA 129..1200 1..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:49:25 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
X 4959929..4961000 1..1072 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:49:25 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
X 4959929..4961000 1..1072 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:49:25 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
X 4959929..4961000 1..1072 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:54:14 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4853962..4855033 1..1072 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:58 Download gff for AT22731.complete
Subject Subject Range Query Range Percent Splice Strand
X 4968027..4969098 1..1072 100   Minus

AT22731.hyp Sequence

Translation from 1 to 963

> AT22731.hyp
RDLGDCHKANLADIDIIARTTTKCQLGGEQMISPGYQRLGPSLDRVPDDE
ETDSQEEEMEILPCGMGEEGITTDEETKTLITIQGLDEILKRIDILRSQL
RRNQQLEDISQPSVMPEDPISCSGLNAKQSEIRCIQRAQHHIQCQLTELL
CRYDALRNMLRSLGETWTCLERRIADIRGQNRVHLAWTEECANDLSNCQQ
RHRSLAAVKLTKKMALLVTKTNMSSGFRYSRRYLRHALIARHINDFRYEI
AELKVLSEEIFSEIDGRLDQIKMKAQRFGVVFSTTPRQSNLIADGTGNTE
LTELTDATETFTVPRSNNPK*

AT22731.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
SIP3-PA 290 CG15468-PA 1..290 31..320 1494 100 Plus
CG14556-PB 334 CG14556-PB 11..301 2..278 205 22.6 Plus

AT22731.pep Sequence

Translation from 91 to 963

> AT22731.pep
MISPGYQRLGPSLDRVPDDEETDSQEEEMEILPCGMGEEGITTDEETKTL
ITIQGLDEILKRIDILRSQLRRNQQLEDISQPSVMPEDPISCSGLNAKQS
EIRCIQRAQHHIQCQLTELLCRYDALRNMLRSLGETWTCLERRIADIRGQ
NRVHLAWTEECANDLSNCQQRHRSLAAVKLTKKMALLVTKTNMSSGFRYS
RRYLRHALIARHINDFRYEIAELKVLSEEIFSEIDGRLDQIKMKAQRFGV
VFSTTPRQSNLIADGTGNTELTELTDATETFTVPRSNNPK*

AT22731.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20335-PA 332 GF20335-PA 66..305 19..246 437 40.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18510-PA 334 GG18510-PA 57..332 1..273 1052 76.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG15468-PA 290 CG15468-PA 1..290 1..290 1494 100 Plus
CG14556-PB 334 CG14556-PB 119..301 66..248 194 25.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21587-PA 334 GI21587-PA 176..313 102..239 146 26.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13078-PB 342 GA13078-PB 43..308 25..249 203 23.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12658-PA 350 GM12658-PA 57..350 1..290 1168 80.7 Plus
Dsec\GM10308-PA 509 GM10308-PA 180..302 101..223 170 30.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15807-PA 341 GJ15807-PA 170..320 88..242 187 28.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24905-PA 286 GK24905-PA 45..275 13..248 150 24.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16827-PA 351 GE16827-PA 59..350 3..290 1138 76.7 Plus
Dyak\GE23656-PA 521 GE23656-PA 162..317 66..226 164 24.2 Plus