BDGP Sequence Production Resources |
Search the DGRC for AT22870
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 228 |
Well: | 70 |
Vector: | pOTB7 |
Associated Gene/Transcript | mtacp1-RB |
Protein status: | AT22870.pep: gold |
Preliminary Size: | 1122 |
Sequenced Size: | 783 |
Gene | Date | Evidence |
---|---|---|
CG9160 | 2002-01-01 | Sim4 clustering to Release 2 |
CG9160 | 2002-01-18 | Blastp of sequenced clone |
CG9160 | 2003-01-01 | Sim4 clustering to Release 3 |
mtacp1 | 2008-04-29 | Release 5.5 accounting |
mtacp1 | 2008-08-15 | Release 5.9 accounting |
mtacp1 | 2008-12-18 | 5.12 accounting |
783 bp (783 high quality bases) assembled on 2002-01-18
GenBank Submission: AY089404
> AT22870.complete CACAAAAGAAGATTTCAGCTAACGTTACTACTGAAATTCATGTGAATTAA TATACCACTAACAATTATTTAACTGTAAATTATAGTTGGGAAAGTTACTT ACTCATTATTCAAGTATTAAGTATTTTTAGTATTTATTTGCGTAAGTTGA GAAACAGCTTAGTACATTGCGCATACGGTCACACTGCTACCTTGCTGTCT TTTTCTTGCTCCAGCACTTTTACATAATCTTGAAAACTCAGCGAGAACCG AGATGTCGTTCACACAGATCGCGCGCAGCTGCAGTCGACTGGCGGCCACT TTGGCCCCAAGGAGGGTCGCCTCCGGCATTCTCATCCAATCACAGGCCTC CAGGATGATGCACAGGATCGCCGTGCCATCGATGACCAGCCAGTTGAGCC AAAAGTTCGGTGTGCGCAGCTACTCGGCCAAGAGCACCATCGAGGACATC AAGTTCCGCGTGCTAAAGGTTGTCTCCGCCTACGACAAAGTGACCGCCGA AAAGCTCAACGTTGAGTCGCACTTCATCAACGACTTGGGACTGGATTCCT TGGACCACGTGGAGGTCATCATGGCCATGGAGGACGAGTTCGGTTTCGAG ATCCCCGACTCTGATGCCGAGAAGCTGCTTAAACCTGCCGACATTATTAA GTACGTCGCCGACAAGGAGGATGTGTACGAGTAAATTGTAATTGTAATGC AAGCCATTGAACGGATTACACTTAAATTTAAATAGAAAACAAGTCAAATA CAATTTGATCAACTGAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mtacp1-RB | 904 | mtacp1-RB | 1..771 | 1..771 | 3840 | 99.8 | Plus |
mtacp1.a | 972 | mtacp1.a | 1..490 | 1..490 | 2450 | 100 | Plus |
mtacp1-RA | 931 | mtacp1-RA | 1..406 | 1..406 | 2015 | 99.7 | Plus |
mtacp1.a | 972 | mtacp1.a | 616..885 | 502..771 | 1335 | 99.6 | Plus |
mtacp1-RA | 931 | mtacp1-RA | 529..798 | 502..771 | 1335 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 1330790..1331052 | 503..765 | 1315 | 100 | Plus |
chr3L | 24539361 | chr3L | 1329317..1329560 | 1..243 | 1080 | 97.1 | Plus |
chr3L | 24539361 | chr3L | 1329643..1329802 | 243..402 | 800 | 100 | Plus |
chr3L | 24539361 | chr3L | 1330375..1330476 | 403..504 | 495 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 1331278..1331546 | 503..771 | 1330 | 99.6 | Plus |
3L | 28110227 | 3L | 1329806..1330048 | 1..243 | 1215 | 100 | Plus |
3L | 28110227 | 3L | 1330131..1330290 | 243..402 | 800 | 100 | Plus |
3L | 28110227 | 3L | 1330863..1330964 | 403..504 | 510 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 1331278..1331546 | 503..771 | 1330 | 99.6 | Plus |
3L | 28103327 | 3L | 1329806..1330048 | 1..243 | 1215 | 100 | Plus |
3L | 28103327 | 3L | 1330131..1330290 | 243..402 | 800 | 100 | Plus |
3L | 28103327 | 3L | 1330863..1330964 | 403..504 | 510 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X-element | 4740 | X-element ROXELEMENT 4740bp | 3462..3553 | 580..671 | 117 | 61.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 1329643..1329802 | 243..402 | 100 | -> | Plus |
chr3L | 1330375..1330476 | 403..504 | 99 | -> | Plus |
chr3L | 1329317..1329559 | 1..242 | 97 | -> | Plus |
chr3L | 1330792..1331052 | 505..765 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RB | 1..432 | 253..684 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RB | 1..432 | 253..684 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RB | 1..432 | 253..684 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RB | 1..432 | 253..684 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RB | 1..432 | 253..684 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RB | 1..765 | 1..765 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RB | 1..765 | 1..765 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RB | 1..622 | 144..765 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RB | 1..765 | 1..765 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mtacp1-RB | 1..622 | 144..765 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1330131..1330290 | 243..402 | 100 | -> | Plus |
3L | 1330863..1330964 | 403..504 | 100 | -> | Plus |
3L | 1331280..1331540 | 505..765 | 100 | Plus | |
3L | 1329806..1330047 | 1..242 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1330131..1330290 | 243..402 | 100 | -> | Plus |
3L | 1330863..1330964 | 403..504 | 100 | -> | Plus |
3L | 1331280..1331540 | 505..765 | 100 | Plus | |
3L | 1329806..1330047 | 1..242 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1330131..1330290 | 243..402 | 100 | -> | Plus |
3L | 1330863..1330964 | 403..504 | 100 | -> | Plus |
3L | 1331280..1331540 | 505..765 | 100 | Plus | |
3L | 1329806..1330047 | 1..242 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 1330131..1330290 | 243..402 | 100 | -> | Plus |
arm_3L | 1330863..1330964 | 403..504 | 100 | -> | Plus |
arm_3L | 1329806..1330047 | 1..242 | 100 | -> | Plus |
arm_3L | 1331280..1331540 | 505..765 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1329806..1330047 | 1..242 | 100 | -> | Plus |
3L | 1330131..1330290 | 243..402 | 100 | -> | Plus |
3L | 1330863..1330964 | 403..504 | 100 | -> | Plus |
3L | 1331280..1331540 | 505..765 | 100 | Plus |
Translation from 252 to 683
> AT22870.hyp MSFTQIARSCSRLAATLAPRRVASGILIQSQASRMMHRIAVPSMTSQLSQ KFGVRSYSAKSTIEDIKFRVLKVVSAYDKVTAEKLNVESHFINDLGLDSL DHVEVIMAMEDEFGFEIPDSDAEKLLKPADIIKYVADKEDVYE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mtacp1-PB | 143 | CG9160-PB | 1..143 | 1..143 | 703 | 100 | Plus |
mtacp1-PC | 181 | CG9160-PC | 1..181 | 1..143 | 637 | 76.8 | Plus |
mtacp1-PA | 152 | CG9160-PA | 1..152 | 1..143 | 572 | 81.6 | Plus |
Translation from 252 to 683
> AT22870.pep MSFTQIARSCSRLAATLAPRRVASGILIQSQASRMMHRIAVPSMTSQLSQ KFGVRSYSAKSTIEDIKFRVLKVVSAYDKVTAEKLNVESHFINDLGLDSL DHVEVIMAMEDEFGFEIPDSDAEKLLKPADIIKYVADKEDVYE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24455-PA | 185 | GF24455-PA | 1..185 | 1..143 | 584 | 65.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14782-PA | 186 | GG14782-PA | 1..186 | 1..143 | 680 | 74.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15216-PA | 184 | GH15216-PA | 1..184 | 1..143 | 525 | 59.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ND-ACP-PB | 143 | CG9160-PB | 1..143 | 1..143 | 703 | 100 | Plus |
ND-ACP-PC | 181 | CG9160-PC | 1..181 | 1..143 | 637 | 76.8 | Plus |
ND-ACP-PA | 152 | CG9160-PA | 1..152 | 1..143 | 572 | 81.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11927-PA | 186 | GI11927-PA | 1..186 | 1..143 | 522 | 59.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21696-PA | 143 | GL21696-PA | 1..143 | 1..143 | 641 | 83.2 | Plus |
Dper\GL16180-PA | 189 | GL16180-PA | 1..189 | 1..143 | 584 | 63 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21583-PA | 189 | GA21583-PA | 1..189 | 1..143 | 590 | 63.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14402-PA | 186 | GM14402-PA | 1..186 | 1..143 | 692 | 76.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13611-PA | 186 | GD13611-PA | 1..186 | 1..143 | 692 | 76.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12150-PA | 184 | GJ12150-PA | 1..184 | 1..143 | 542 | 60.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13357-PA | 181 | GK13357-PA | 1..181 | 1..143 | 558 | 65 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\mtacp1-PA | 186 | GE21146-PA | 1..186 | 1..143 | 684 | 75.8 | Plus |