Clone AT22870 Report

Search the DGRC for AT22870

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:228
Well:70
Vector:pOTB7
Associated Gene/Transcriptmtacp1-RB
Protein status:AT22870.pep: gold
Preliminary Size:1122
Sequenced Size:783

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9160 2002-01-01 Sim4 clustering to Release 2
CG9160 2002-01-18 Blastp of sequenced clone
CG9160 2003-01-01 Sim4 clustering to Release 3
mtacp1 2008-04-29 Release 5.5 accounting
mtacp1 2008-08-15 Release 5.9 accounting
mtacp1 2008-12-18 5.12 accounting

Clone Sequence Records

AT22870.complete Sequence

783 bp (783 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089404

> AT22870.complete
CACAAAAGAAGATTTCAGCTAACGTTACTACTGAAATTCATGTGAATTAA
TATACCACTAACAATTATTTAACTGTAAATTATAGTTGGGAAAGTTACTT
ACTCATTATTCAAGTATTAAGTATTTTTAGTATTTATTTGCGTAAGTTGA
GAAACAGCTTAGTACATTGCGCATACGGTCACACTGCTACCTTGCTGTCT
TTTTCTTGCTCCAGCACTTTTACATAATCTTGAAAACTCAGCGAGAACCG
AGATGTCGTTCACACAGATCGCGCGCAGCTGCAGTCGACTGGCGGCCACT
TTGGCCCCAAGGAGGGTCGCCTCCGGCATTCTCATCCAATCACAGGCCTC
CAGGATGATGCACAGGATCGCCGTGCCATCGATGACCAGCCAGTTGAGCC
AAAAGTTCGGTGTGCGCAGCTACTCGGCCAAGAGCACCATCGAGGACATC
AAGTTCCGCGTGCTAAAGGTTGTCTCCGCCTACGACAAAGTGACCGCCGA
AAAGCTCAACGTTGAGTCGCACTTCATCAACGACTTGGGACTGGATTCCT
TGGACCACGTGGAGGTCATCATGGCCATGGAGGACGAGTTCGGTTTCGAG
ATCCCCGACTCTGATGCCGAGAAGCTGCTTAAACCTGCCGACATTATTAA
GTACGTCGCCGACAAGGAGGATGTGTACGAGTAAATTGTAATTGTAATGC
AAGCCATTGAACGGATTACACTTAAATTTAAATAGAAAACAAGTCAAATA
CAATTTGATCAACTGAAAAAAAAAAAAAAAAAA

AT22870.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
mtacp1-RB 904 mtacp1-RB 1..771 1..771 3840 99.8 Plus
mtacp1.a 972 mtacp1.a 1..490 1..490 2450 100 Plus
mtacp1-RA 931 mtacp1-RA 1..406 1..406 2015 99.7 Plus
mtacp1.a 972 mtacp1.a 616..885 502..771 1335 99.6 Plus
mtacp1-RA 931 mtacp1-RA 529..798 502..771 1335 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1330790..1331052 503..765 1315 100 Plus
chr3L 24539361 chr3L 1329317..1329560 1..243 1080 97.1 Plus
chr3L 24539361 chr3L 1329643..1329802 243..402 800 100 Plus
chr3L 24539361 chr3L 1330375..1330476 403..504 495 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:56:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1331278..1331546 503..771 1330 99.6 Plus
3L 28110227 3L 1329806..1330048 1..243 1215 100 Plus
3L 28110227 3L 1330131..1330290 243..402 800 100 Plus
3L 28110227 3L 1330863..1330964 403..504 510 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1331278..1331546 503..771 1330 99.6 Plus
3L 28103327 3L 1329806..1330048 1..243 1215 100 Plus
3L 28103327 3L 1330131..1330290 243..402 800 100 Plus
3L 28103327 3L 1330863..1330964 403..504 510 100 Plus
Blast to na_te.dros performed 2019-03-15 17:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
X-element 4740 X-element ROXELEMENT 4740bp 3462..3553 580..671 117 61.3 Plus

AT22870.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:46:03 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1329643..1329802 243..402 100 -> Plus
chr3L 1330375..1330476 403..504 99 -> Plus
chr3L 1329317..1329559 1..242 97 -> Plus
chr3L 1330792..1331052 505..765 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:18:12 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RB 1..432 253..684 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:32:01 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RB 1..432 253..684 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:44:57 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RB 1..432 253..684 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:22:15 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RB 1..432 253..684 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:45:44 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RB 1..432 253..684 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:02:18 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RB 1..765 1..765 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:32:01 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RB 1..765 1..765 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:44:57 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RB 1..622 144..765 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:22:15 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RB 1..765 1..765 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:45:44 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
mtacp1-RB 1..622 144..765 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:46:03 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1330131..1330290 243..402 100 -> Plus
3L 1330863..1330964 403..504 100 -> Plus
3L 1331280..1331540 505..765 100   Plus
3L 1329806..1330047 1..242 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:46:03 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1330131..1330290 243..402 100 -> Plus
3L 1330863..1330964 403..504 100 -> Plus
3L 1331280..1331540 505..765 100   Plus
3L 1329806..1330047 1..242 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:46:03 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1330131..1330290 243..402 100 -> Plus
3L 1330863..1330964 403..504 100 -> Plus
3L 1331280..1331540 505..765 100   Plus
3L 1329806..1330047 1..242 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:44:57 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1330131..1330290 243..402 100 -> Plus
arm_3L 1330863..1330964 403..504 100 -> Plus
arm_3L 1329806..1330047 1..242 100 -> Plus
arm_3L 1331280..1331540 505..765 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:55:59 Download gff for AT22870.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1329806..1330047 1..242 100 -> Plus
3L 1330131..1330290 243..402 100 -> Plus
3L 1330863..1330964 403..504 100 -> Plus
3L 1331280..1331540 505..765 100   Plus

AT22870.hyp Sequence

Translation from 252 to 683

> AT22870.hyp
MSFTQIARSCSRLAATLAPRRVASGILIQSQASRMMHRIAVPSMTSQLSQ
KFGVRSYSAKSTIEDIKFRVLKVVSAYDKVTAEKLNVESHFINDLGLDSL
DHVEVIMAMEDEFGFEIPDSDAEKLLKPADIIKYVADKEDVYE*

AT22870.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
mtacp1-PB 143 CG9160-PB 1..143 1..143 703 100 Plus
mtacp1-PC 181 CG9160-PC 1..181 1..143 637 76.8 Plus
mtacp1-PA 152 CG9160-PA 1..152 1..143 572 81.6 Plus

AT22870.pep Sequence

Translation from 252 to 683

> AT22870.pep
MSFTQIARSCSRLAATLAPRRVASGILIQSQASRMMHRIAVPSMTSQLSQ
KFGVRSYSAKSTIEDIKFRVLKVVSAYDKVTAEKLNVESHFINDLGLDSL
DHVEVIMAMEDEFGFEIPDSDAEKLLKPADIIKYVADKEDVYE*

AT22870.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24455-PA 185 GF24455-PA 1..185 1..143 584 65.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14782-PA 186 GG14782-PA 1..186 1..143 680 74.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15216-PA 184 GH15216-PA 1..184 1..143 525 59.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
ND-ACP-PB 143 CG9160-PB 1..143 1..143 703 100 Plus
ND-ACP-PC 181 CG9160-PC 1..181 1..143 637 76.8 Plus
ND-ACP-PA 152 CG9160-PA 1..152 1..143 572 81.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11927-PA 186 GI11927-PA 1..186 1..143 522 59.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21696-PA 143 GL21696-PA 1..143 1..143 641 83.2 Plus
Dper\GL16180-PA 189 GL16180-PA 1..189 1..143 584 63 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21583-PA 189 GA21583-PA 1..189 1..143 590 63.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14402-PA 186 GM14402-PA 1..186 1..143 692 76.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13611-PA 186 GD13611-PA 1..186 1..143 692 76.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12150-PA 184 GJ12150-PA 1..184 1..143 542 60.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13357-PA 181 GK13357-PA 1..181 1..143 558 65 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\mtacp1-PA 186 GE21146-PA 1..186 1..143 684 75.8 Plus