Clone AT22957 Report

Search the DGRC for AT22957

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:229
Well:57
Vector:pOTB7
Associated Gene/TranscriptCG5213-RA
Protein status:AT22957.pep: gold
Preliminary Size:921
Sequenced Size:1037

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5213 2002-01-01 Sim4 clustering to Release 2
CG5213 2002-01-18 Blastp of sequenced clone
CG5213 2003-01-01 Sim4 clustering to Release 3
CG5213 2008-04-29 Release 5.5 accounting
CG5213 2008-08-15 Release 5.9 accounting
CG5213 2008-12-18 5.12 accounting

Clone Sequence Records

AT22957.complete Sequence

1037 bp (1037 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089405

> AT22957.complete
CAAACACATTCTGAAAAAAAACTTTTAACATTTGGAAGGGCAGCTTTGCA
GTATTTTTAGAATTTTCAGTCAATTTGGGATATTATAATCATTCTAAAAT
TTTCTACGCCAAGTGTTTCATTTGGATCCCATTCCGAAGAAAGCATAAGA
TCTCTGCGGTCATCTTTCACCTTTGCTTCTATCTATAGCGCAGAGAAAAT
GACCAAGAAGGAGTCATCCGTCCCGACGCTATGTTGGGGATACGCCGGGA
TACGCGGCATGTTCCAAACTGGAAGACCAGTGGATCCGCCCCCTCCTCTC
CCTAATTTGCGGATGAAGACGAACCTGATCCTCAACTACCTTCCGCAGGA
CATGACGGAGTCTGAGCTGCACCGTCTCTTCTCCAAGTTCGGTGAGATCC
GCAAGGCCAAGATCATCCGCCACCGCAGGACTGGCATAAGCTGTTGCTAC
GGATTCGTCGACTACGTGTCGGAACGCCAGGCGGCTGCTGCCGTGAATGG
CATGGATGGCTACGAGACTCGCGGCAAGCGACTGAAAGTGGCCTTCGCCC
GACCTTCGGAATATGAAAGCACCAGCTCCAGCCTGTACGTGGGGAACCTG
CCCACGTACATGGATGAGAAGAAGGTACGAGAACTCTTCGCCACCTACGG
CAACATCGTGGATGTGAACTTGCTGCGCCACAAGTTCAACAATAGGTCCC
GTGGCGTGGCCTTCTTGCAATTTGAGTTGGTCCGCGACGCCGAGGTGGCC
AAGTACGGCATGGATCGGTACATGATCGAAGGCGCCTCCCGGCCCCTGAC
GGTCAAGTTCGTGGAGCGCGAGAAAAAAGGCTCGAGTTCTACCTCCAGTG
GCTCCCAGTATAAGGACAAGCGTAAATCTTCCCCACCACCCTACAAGCGT
CGCGAGAGGACGAACGATCATCATGTGTCTAAGCGTTCTCGAGATTCGGA
CTAATCATTATGCGTATTTTTGATAGAACTTGCTGATTAATTTGATTAAT
ATATATATAGAACCTGTAAAAAAAAAAAAAAAAAAAA

AT22957.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG5213-RA 1025 CG5213-RA 3..1021 1..1019 5095 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11319307..11320323 1..1017 5070 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:56:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15494604..15495622 1..1019 5095 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:57:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15235435..15236453 1..1019 5095 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:23:18 has no hits.

AT22957.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:24:24 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11319307..11320323 1..1017 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:18:20 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5213-RA 1..756 199..954 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:46:33 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5213-RA 1..756 199..954 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:40:22 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5213-RA 1..756 199..954 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:14:46 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5213-RA 1..756 199..954 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:32:12 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5213-RA 1..756 199..954 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:10:51 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5213-RA 3..1019 1..1017 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:46:33 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5213-RA 3..1019 1..1017 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:40:22 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5213-RA 3..1019 1..1017 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:14:46 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5213-RA 3..1019 1..1017 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:32:12 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
CG5213-RA 3..1019 1..1017 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:24 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15494604..15495620 1..1017 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:24 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15494604..15495620 1..1017 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:24 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15494604..15495620 1..1017 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:40:22 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11320326..11321342 1..1017 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:48:30 Download gff for AT22957.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15235435..15236451 1..1017 100   Plus

AT22957.pep Sequence

Translation from 198 to 953

> AT22957.pep
MTKKESSVPTLCWGYAGIRGMFQTGRPVDPPPPLPNLRMKTNLILNYLPQ
DMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVN
GMDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATY
GNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPL
TVKFVEREKKGSSSTSSGSQYKDKRKSSPPPYKRRERTNDHHVSKRSRDS
D*

AT22957.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18529-PA 417 GF18529-PA 129..320 24..219 440 47.4 Plus
Dana\GF20968-PA 379 GF20968-PA 127..301 40..214 358 40.6 Plus
Dana\GF21012-PA 757 GF21012-PA 108..281 41..214 353 42 Plus
Dana\GF14992-PA 660 GF14992-PA 97..269 40..207 319 37 Plus
Dana\GF21392-PA 353 GF21392-PA 25..204 40..204 301 35.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16933-PA 255 GG16933-PA 1..255 1..251 824 67.2 Plus
Dere\GG17637-PA 335 GG17637-PA 84..258 40..214 358 40.6 Plus
Dere\GG12847-PA 513 GG12847-PA 101..274 41..214 358 41.4 Plus
Dere\GG12756-PA 466 GG12756-PA 144..309 40..204 325 39.2 Plus
Dere\GG24901-PA 446 GG24901-PA 111..280 40..204 317 37.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24172-PA 365 GH24172-PA 116..290 40..214 358 40.6 Plus
Dgri\GH12116-PA 918 GH12116-PA 183..356 41..214 353 41.4 Plus
Dgri\GH13638-PA 726 GH13638-PA 112..279 40..207 324 37.5 Plus
Dgri\GH12602-PA 511 GH12602-PA 176..354 40..204 300 36.3 Plus
Dgri\GH24423-PA 353 GH24423-PA 25..204 40..204 297 35 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG5213-PA 251 CG5213-PA 1..251 1..251 1313 100 Plus
Sxl-PE 314 CG43770-PE 85..275 41..231 355 38.7 Plus
Sxl-PA 314 CG43770-PA 85..275 41..231 355 38.7 Plus
Sxl-PAB 322 CG43770-PAB 93..283 41..231 355 38.7 Plus
Sxl-PAC 331 CG43770-PAC 102..292 41..231 355 38.7 Plus
Sxl-PR 342 CG43770-PR 115..305 41..231 355 38.7 Plus
Sxl-PC 344 CG43770-PC 115..305 41..231 355 38.7 Plus
Sxl-PN 344 CG43770-PN 115..305 41..231 355 38.7 Plus
Sxl-PW 344 CG43770-PW 117..307 41..231 355 38.7 Plus
Sxl-PJ 346 CG43770-PJ 117..307 41..231 355 38.7 Plus
Sxl-PG 346 CG43770-PG 117..307 41..231 355 38.7 Plus
Sxl-PP 352 CG43770-PP 125..315 41..231 355 38.7 Plus
Sxl-PT 354 CG43770-PT 125..315 41..231 355 38.7 Plus
Sxl-PD 354 CG43770-PD 125..315 41..231 355 38.7 Plus
Sxl-PL 354 CG43770-PL 125..315 41..231 355 38.7 Plus
Sxl-PO 364 CG43770-PO 115..305 41..231 355 38.7 Plus
Sxl-PH 366 CG43770-PH 117..307 41..231 355 38.7 Plus
Sxl-PY 708 CG43770-PY 125..315 41..231 355 38.7 Plus
Sxl-PX 722 CG43770-PX 117..307 41..231 355 38.7 Plus
ssx-PE 443 CG3056-PE 93..266 41..214 348 41.4 Plus
ssx-PB 443 CG3056-PB 93..266 41..214 348 41.4 Plus
ssx-PD 485 CG3056-PD 93..266 41..214 348 41.4 Plus
Rbp9-PH 439 CG3151-PH 109..290 40..221 325 36.3 Plus
Rbp9-PG 439 CG3151-PG 109..290 40..221 325 36.3 Plus
Rbp9-PF 439 CG3151-PF 109..290 40..221 325 36.3 Plus
Rbp9-PE 439 CG3151-PE 109..290 40..221 325 36.3 Plus
Rbp9-PJ 684 CG3151-PJ 109..290 40..221 325 36.3 Plus
Rbp9-PK 444 CG3151-PK 109..295 40..221 312 35.3 Plus
Rbp9-PI 444 CG3151-PI 109..295 40..221 312 35.3 Plus
Rbp9-PB 444 CG3151-PB 109..295 40..221 312 35.3 Plus
Rbp9-PC 444 CG3151-PC 109..295 40..221 312 35.3 Plus
fne-PJ 353 CG4396-PJ 21..214 36..214 294 33 Plus
fne-PI 353 CG4396-PI 21..214 36..214 294 33 Plus
fne-PD 353 CG4396-PD 21..214 36..214 294 33 Plus
fne-PE 356 CG4396-PE 21..217 36..214 291 32.5 Plus
fne-PH 356 CG4396-PH 21..217 36..214 291 32.5 Plus
fne-PG 356 CG4396-PG 21..217 36..214 291 32.5 Plus
fne-PB 356 CG4396-PB 21..217 36..214 291 32.5 Plus
fne-PA 356 CG4396-PA 21..217 36..214 291 32.5 Plus
fne-PC 356 CG4396-PC 21..217 36..214 291 32.5 Plus
elav-PC 479 CG4262-PC 144..322 40..204 283 36.3 Plus
elav-PB 479 CG4262-PB 144..322 40..204 283 36.3 Plus
elav-PA 483 CG4262-PA 148..326 40..204 283 36.3 Plus
elav-PD 483 CG4262-PD 148..326 40..204 283 36.3 Plus
shep-PB 499 CG32423-PB 135..302 40..206 202 32.2 Plus
shep-PD 499 CG32423-PD 135..302 40..206 202 32.2 Plus
shep-PE 379 CG32423-PE 20..189 40..206 198 31.6 Plus
shep-PG 379 CG32423-PG 20..189 40..206 198 31.6 Plus
shep-PH 371 CG32423-PH 20..187 40..206 196 31.8 Plus
shep-PI 377 CG32423-PI 20..187 40..206 196 31.8 Plus
shep-PA 578 CG32423-PA 230..388 40..206 194 31.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10157-PA 356 GI10157-PA 31..204 41..214 443 46.6 Plus
Dmoj\GI16327-PA 716 GI16327-PA 250..420 41..214 363 43.1 Plus
Dmoj\GI21573-PA 367 GI21573-PA 116..290 40..214 358 40.6 Plus
Dmoj\GI11879-PA 724 GI11879-PA 123..295 40..207 318 37 Plus
Dmoj\GI15436-PA 475 GI15436-PA 140..318 40..204 300 36.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14245-PA 618 GL14245-PA 120..293 41..214 362 41.4 Plus
Dper\GL26885-PA 377 GL26885-PA 126..300 40..214 357 40.6 Plus
Dper\GL26299-PA 678 GL26299-PA 109..276 40..207 332 38.1 Plus
Dper\GL20165-PA 496 GL20165-PA 161..339 40..204 301 36.3 Plus
Dper\GL22975-PA 385 GL22975-PA 25..204 40..204 299 35 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22715-PA 672 GA22715-PA 120..293 41..214 361 41.4 Plus
Dpse\GA22653-PA 377 GA22653-PA 126..300 40..214 357 40.6 Plus
Dpse\GA28809-PA 692 GA28809-PA 118..290 40..207 319 37 Plus
Dpse\GA18065-PA 496 GA18065-PA 161..339 40..204 301 36.3 Plus
Dpse\GA22283-PA 353 GA22283-PA 25..204 40..204 297 35 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24242-PA 244 GM24242-PA 1..244 1..251 1042 78.9 Plus
Dsec\Sxl-PA 301 GM17480-PA 116..287 40..211 362 41.3 Plus
Dsec\GM19131-PA 488 GM19131-PA 93..266 41..214 357 41.4 Plus
Dsec\GM19036-PA 466 GM19036-PA 144..309 40..204 324 39.2 Plus
Dsec\GM18380-PA 650 GM18380-PA 315..485 40..205 320 37.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19030-PA 244 GD19030-PA 1..244 1..251 1035 78.1 Plus
Dsim\GD16475-PA 466 GD16475-PA 144..309 40..204 324 39.2 Plus
Dsim\Sxl-PA 301 GD16165-PA 116..260 40..187 317 43.2 Plus
Dsim\GD16553-PA 226 GD16553-PA 93..225 41..173 313 47.4 Plus
Dsim\GD17091-PA 371 GD17091-PA 25..208 40..205 301 34.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10859-PA 388 GJ10859-PA 29..197 41..209 415 47.3 Plus
Dvir\Sxl-PA 368 GJ16698-PA 117..291 40..214 358 40.6 Plus
Dvir\GJ13991-PA 725 GJ13991-PA 101..273 40..207 316 37 Plus
Dvir\ssx-PA 428 GJ15667-PA 26..190 50..214 308 38.8 Plus
Dvir\GJ16518-PA 353 GJ16518-PA 25..204 40..204 297 35 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16445-PA 373 GK16445-PA 120..294 40..214 359 40.6 Plus
Dwil\GK16696-PA 508 GK16696-PA 112..285 41..214 359 40.8 Plus
Dwil\GK14865-PA 725 GK14865-PA 120..299 40..214 314 36.1 Plus
Dwil\GK16120-PA 509 GK16120-PA 174..352 40..204 300 36.3 Plus
Dwil\GK25647-PA 353 GK25647-PA 25..204 40..204 297 35 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24318-PA 256 GE24318-PA 1..256 1..251 913 71.2 Plus
Dyak\GE17544-PA 335 GE17544-PA 84..258 40..214 358 40.6 Plus
Dyak\GE16683-PA 563 GE16683-PA 113..286 41..214 358 41.4 Plus
Dyak\GE18193-PA 446 GE18193-PA 111..280 40..204 317 37.6 Plus
Dyak\GE16581-PA 478 GE16581-PA 143..321 40..204 301 36.3 Plus

AT22957.hyp Sequence

Translation from 198 to 953

> AT22957.hyp
MTKKESSVPTLCWGYAGIRGMFQTGRPVDPPPPLPNLRMKTNLILNYLPQ
DMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVN
GMDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATY
GNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPL
TVKFVEREKKGSSSTSSGSQYKDKRKSSPPPYKRRERTNDHHVSKRSRDS
D*

AT22957.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG5213-PA 251 CG5213-PA 1..251 1..251 1313 100 Plus
Sxl-PE 314 CG43770-PE 85..275 41..231 355 38.7 Plus
Sxl-PA 314 CG43770-PA 85..275 41..231 355 38.7 Plus
Sxl-PAB 322 CG43770-PAB 93..283 41..231 355 38.7 Plus
Sxl-PAC 331 CG43770-PAC 102..292 41..231 355 38.7 Plus