Clone AT23217 Report

Search the DGRC for AT23217

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:232
Well:17
Vector:pOTB7
Associated Gene/TranscriptCG11694-RA
Protein status:AT23217.pep: gold
Preliminary Size:786
Sequenced Size:901

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11694 2002-01-01 Sim4 clustering to Release 2
CG11694 2002-01-03 Blastp of sequenced clone
CG11694 2003-01-01 Sim4 clustering to Release 3
CG11694 2008-04-29 Release 5.5 accounting
CG11694 2008-08-15 Release 5.9 accounting
CG11694 2008-12-18 5.12 accounting

Clone Sequence Records

AT23217.complete Sequence

901 bp (901 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075265

> AT23217.complete
ACTATTTCGAGTTAAGCATGGAGATAGCACGAATCGCATTTCTACTTTTC
TTCCTGTTCTCAGATCATTCTGCGGGCCACAAGTTGCCGCAGTCCTCCAA
TGAGATAGCTGCTCTAATGTCGGATCATCATGGTGATGGCGACAACAGTG
TGTCGTCATCCTCCGGCGGTGCCCCGTGCGACTTCAAGATGAATGGAAAG
ACCAGGGTAAAGGCCTCATGCATTGCGCAGAAGGCGGCCAAGGAAGCCAT
GGAGGCATCCGATGCCCAGATAGAGGCTGGCGAGGCAGCTGCCCGCCAGG
TGAAGCAGCAACTGGCCGACAAAGCGCTGGCCGCAGCCAAGGCGGCAGAA
GCTGCTCTGGCCGGCAAGCAACAGATTGTCGAGCAACTGGAGTCCGAGGT
GCGCGAGGGGGAGCTAGTGGTCCAGGAGGAGAGCACCTTGTTACAGACCA
CCCAAACTACTTATGCTGCGGCCGGGCAAGCGGCCAAACAGGCGGCAGAT
CAGCTGAACACCATTACGCTGGCGGTGAAGAATGCGCAGGATAATGTGGT
CAACTCGGAGCACGTGGCCAGTGGCGCTCAGCAGGAGCTGGGCGAGAAGC
AACAGCTTGTGGAAGCGGCCAAGAAGCGGGTGGAGCTATTGCTCCGCCAG
CTGGAGGTGGCCCGTGTGGATTTCAAGAATACCAAAAACGCCGCCGAGAA
GGCAGCCTGTGCTGCCCAGGAGGCCAGGCATAGGGCCACCAGGGAGCGCA
GGAGGGCGGAACTGAGGCACTTACTCTGGCTGAAGAGGGGGCGCACCAAC
TGAAGCCAATAACTTGTATATCTTATATTTTATTTTACTTTGCATTTTCA
AAAGGGAGAATATAATTCAGTTTTATTAAATTCAAAAAAAAAAAAAAAAA
A

AT23217.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG11694-RA 883 CG11694-RA 1..883 1..883 4415 100 Plus
CG14354-RA 1089 CG14354-RA 382..528 284..430 240 77.5 Plus
CG14840-RA 1006 CG14840-RA 637..714 558..635 195 83.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4137218..4138100 883..1 4415 100 Minus
chr3R 27901430 chr3R 21638732..21638940 222..430 250 74.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:57:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8311201..8312085 885..1 4425 100 Minus
3R 32079331 3R 25815759..25815967 222..430 250 74.6 Plus
3R 32079331 3R 14260500..14260577 635..558 195 83.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8052032..8052916 885..1 4425 100 Minus
3R 31820162 3R 25556652..25556798 284..430 240 77.5 Plus
3R 31820162 3R 14001331..14001408 635..558 195 83.3 Minus
Blast to na_te.dros performed 2019-03-15 11:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 624..654 830..860 110 83.9 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9654..9684 830..860 110 83.9 Plus

AT23217.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:47:41 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4137218..4138100 1..883 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:18:52 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
CG11694-RA 1..786 18..803 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:57:14 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
CG11694-RA 1..786 18..803 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:32:47 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
CG11694-RA 1..786 18..803 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:22:01 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
CG11694-RA 1..786 18..803 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:41:59 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
CG11694-RA 1..786 18..803 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:21:45 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
CG11694-RA 1..883 1..883 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:57:14 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
CG11694-RA 1..883 1..883 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:32:47 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
CG11694-RA 53..935 1..883 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:22:01 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
CG11694-RA 1..883 1..883 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:41:59 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
CG11694-RA 53..935 1..883 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:41 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8311203..8312085 1..883 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:41 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8311203..8312085 1..883 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:41 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8311203..8312085 1..883 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:32:47 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4136925..4137807 1..883 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:56:54 Download gff for AT23217.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8052034..8052916 1..883 100   Minus

AT23217.hyp Sequence

Translation from 2 to 802

> AT23217.hyp
YFELSMEIARIAFLLFFLFSDHSAGHKLPQSSNEIAALMSDHHGDGDNSV
SSSSGGAPCDFKMNGKTRVKASCIAQKAAKEAMEASDAQIEAGEAAARQV
KQQLADKALAAAKAAEAALAGKQQIVEQLESEVREGELVVQEESTLLQTT
QTTYAAAGQAAKQAADQLNTITLAVKNAQDNVVNSEHVASGAQQELGEKQ
QLVEAAKKRVELLLRQLEVARVDFKNTKNAAEKAACAAQEARHRATRERR
RAELRHLLWLKRGRTN*

AT23217.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG11694-PA 261 CG11694-PA 1..261 6..266 1277 100 Plus
CG14840-PA 300 CG14840-PA 9..276 11..259 496 46.6 Plus
CG14354-PA 298 CG14354-PA 11..247 22..253 494 49.8 Plus
CG34459-PC 305 CG34459-PC 90..295 47..245 422 47.6 Plus
CG34459-PB 305 CG34459-PB 90..295 47..245 422 47.6 Plus

AT23217.pep Sequence

Translation from 17 to 802

> AT23217.pep
MEIARIAFLLFFLFSDHSAGHKLPQSSNEIAALMSDHHGDGDNSVSSSSG
GAPCDFKMNGKTRVKASCIAQKAAKEAMEASDAQIEAGEAAARQVKQQLA
DKALAAAKAAEAALAGKQQIVEQLESEVREGELVVQEESTLLQTTQTTYA
AAGQAAKQAADQLNTITLAVKNAQDNVVNSEHVASGAQQELGEKQQLVEA
AKKRVELLLRQLEVARVDFKNTKNAAEKAACAAQEARHRATRERRRAELR
HLLWLKRGRTN*

AT23217.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16670-PA 204 GF16670-PA 1..196 58..253 535 84.7 Plus
Dana\GF23178-PA 296 GF23178-PA 88..281 53..245 272 55.7 Plus
Dana\GF16773-PA 273 GF16773-PA 14..243 10..251 266 45.6 Plus
Dana\GF23051-PA 286 GF23051-PA 61..259 36..239 244 41.7 Plus
Dana\GF23179-PA 289 GF23179-PA 31..265 6..245 239 50.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17458-PA 259 GG17458-PA 1..259 1..261 759 83.9 Plus
Dere\GG11426-PA 286 GG11426-PA 52..241 59..248 320 56.8 Plus
Dere\GG20633-PA 462 GG20633-PA 63..286 17..240 278 43 Plus
Dere\GG21383-PA 244 GG21383-PA 27..230 48..245 260 49 Plus
Dere\GG16844-PA 281 GG16844-PA 58..236 40..220 256 44.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17423-PA 238 GH17423-PA 21..228 41..250 462 67.1 Plus
Dgri\GH19676-PA 252 GH19676-PA 4..251 6..246 274 48.8 Plus
Dgri\GH19706-PA 199 GH19706-PA 9..199 53..245 271 44 Plus
Dgri\GH19677-PA 263 GH19677-PA 75..258 63..246 258 59.2 Plus
Dgri\GH19678-PA 273 GH19678-PA 17..260 6..256 251 51.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG11694-PA 261 CG11694-PA 1..261 1..261 1277 100 Plus
CG14840-PA 300 CG14840-PA 9..276 6..254 496 46.6 Plus
CG14354-PA 298 CG14354-PA 11..247 17..248 494 49.8 Plus
CG34459-PC 305 CG34459-PC 90..295 42..240 422 47.6 Plus
CG34459-PB 305 CG34459-PB 90..295 42..240 422 47.6 Plus
CG34459-PA 305 CG34459-PA 90..295 42..240 422 47.6 Plus
CG14841-PA 274 CG14841-PA 60..265 39..245 412 47.8 Plus
CG14839-PA 282 CG14839-PA 52..256 39..239 366 44.4 Plus
CG12985-PA 370 CG12985-PA 91..295 36..239 297 36.2 Plus
CG11698-PA 262 CG11698-PA 41..224 50..239 278 36.8 Plus
CG11693-PA 318 CG11693-PA 88..283 33..240 243 34.1 Plus
CG11693-PB 323 CG11693-PB 93..288 33..240 243 34.1 Plus
CG33257-PA 330 CG33257-PA 76..277 41..249 235 31.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22752-PA 265 GI22752-PA 25..259 17..253 489 64.7 Plus
Dmoj\GI20828-PA 301 GI20828-PA 91..286 54..246 325 48 Plus
Dmoj\GI24535-PA 266 GI24535-PA 37..251 39..251 281 54 Plus
Dmoj\GI24534-PA 266 GI24534-PA 105..258 94..247 281 58.4 Plus
Dmoj\GI23042-PA 269 GI23042-PA 64..263 36..239 277 43 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24119-PA 264 GL24119-PA 9..261 7..259 472 61.9 Plus
Dper\GL17739-PA 409 GL17739-PA 116..296 60..240 271 45.9 Plus
Dper\GL21537-PA 289 GL21537-PA 68..224 66..222 260 52.2 Plus
Dper\GL24243-PA 262 GL24243-PA 2..240 5..239 258 36.4 Plus
Dper\GL23292-PA 280 GL23292-PA 23..266 11..255 243 46.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11146-PB 267 GA11146-PB 9..264 7..259 521 60.4 Plus
Dpse\GA27677-PA 402 GA27677-PA 112..292 60..240 274 46.4 Plus
Dpse\GA26323-PA 289 GA26323-PA 68..224 66..222 267 52.9 Plus
Dpse\GA13285-PA 246 GA13285-PA 26..224 42..239 248 45.3 Plus
Dpse\GA13287-PA 278 GA13287-PA 53..260 41..245 235 48.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26352-PA 261 GM26352-PA 1..261 1..261 902 94.3 Plus
Dsec\GM10266-PA 296 GM10266-PA 51..247 55..248 317 53.8 Plus
Dsec\GM25864-PA 302 GM25864-PA 82..281 60..259 286 56.5 Plus
Dsec\GM21727-PA 455 GM21727-PA 55..279 17..240 284 44.5 Plus
Dsec\GM25863-PA 265 GM25863-PA 75..260 54..240 277 51.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21236-PA 296 GD21236-PA 51..247 55..248 311 53.3 Plus
Dsim\GD20435-PA 302 GD20435-PA 82..281 60..259 283 56 Plus
Dsim\GD20434-PA 264 GD20434-PA 59..259 39..240 278 48.5 Plus
Dsim\GD11222-PA 470 GD11222-PA 114..294 60..240 270 49.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22753-PA 219 GJ22753-PA 8..213 48..253 487 68.9 Plus
Dvir\GJ20562-PA 352 GJ20562-PA 59..251 54..243 305 47.7 Plus
Dvir\GJ24630-PA 252 GJ24630-PA 45..249 36..242 302 44 Plus
Dvir\GJ22601-PA 233 GJ22601-PA 72..224 94..246 275 58.2 Plus
Dvir\GJ10194-PA 307 GJ10194-PA 63..284 39..243 270 39.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11064-PA 264 GK11064-PA 7..225 8..223 440 62.6 Plus
Dwil\GK14387-PA 246 GK14387-PA 51..236 60..245 360 62.4 Plus
Dwil\GK22021-PA 418 GK22021-PA 104..297 51..241 304 52.6 Plus
Dwil\GK12192-PA 270 GK12192-PA 71..261 57..247 300 48.7 Plus
Dwil\GK10892-PA 290 GK10892-PA 115..261 94..240 213 61.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24857-PA 260 GE24857-PA 1..257 1..258 771 83.7 Plus
Dyak\GE23621-PA 296 GE23621-PA 62..248 59..245 369 57.2 Plus
Dyak\GE11823-PA 449 GE11823-PA 10..282 8..240 287 40.3 Plus
Dyak\GE10039-PA 278 GE10039-PA 58..264 48..245 283 49.8 Plus
Dyak\GE10040-PA 301 GE10040-PA 83..280 60..257 270 55.6 Plus