BDGP Sequence Production Resources |
Search the DGRC for AT23266
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 232 |
Well: | 66 |
Vector: | pOTB7 |
Associated Gene/Transcript | Tom7-RA |
Protein status: | AT23266.pep: gold |
Sequenced Size: | 396 |
Gene | Date | Evidence |
---|---|---|
CG8226 | 2001-12-17 | Blastp of sequenced clone |
CG8224 | 2002-01-01 | Sim4 clustering to Release 2 |
CG8226 | 2003-01-01 | Sim4 clustering to Release 3 |
Tom7 | 2008-04-29 | Release 5.5 accounting |
Tom7 | 2008-08-15 | Release 5.9 accounting |
Tom7 | 2008-12-18 | 5.12 accounting |
396 bp (396 high quality bases) assembled on 2001-12-17
GenBank Submission: AY070812
> AT23266.complete CTGTTTTATATCGAAAAAAGTGCTGTTTTCCAACACTTCGTTTGCAGTCA GACAAGTTATCATTTCATAATTCGCAAAAGGAGCTAAATTCAATATCCGT ACGAAATGAAGCTATCCGAGGGAGTTAAGGATCGTTTGGGATTTGTGGTT GGAGTCGTCCAGACTGGATTCCACTGGGGATTCGTGCCTCTTGTGCTGTA TTTGGGATTTATGAAGGGAGCTGAGCCTGGCATGCCGCCTCTGAACCTTT TCAGTCTGTTATGGCAGTAAAAATAGTGGACATGATCATTTTGCTGTCGT ATGCCCCGCATTTTGGTTCTGGTTGGGTTTCTGGGCACGGGTGCAGTACC TGCAGCTATTGCAAATAAATATCTGTTACAAAACAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tom7-RA | 624 | Tom7-RA | 133..519 | 1..387 | 1920 | 99.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 4839579..4839757 | 206..384 | 100 | Plus | |
chr2R | 4839265..4839469 | 1..205 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom7-RA | 1..165 | 106..270 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom7-RA | 1..165 | 106..270 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom7-RA | 1..165 | 106..270 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom7-RA | 1..165 | 106..270 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom7-RA | 1..165 | 106..270 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom7-RA | 1..384 | 1..384 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom7-RA | 1..384 | 1..384 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom7-RB | 94..477 | 1..384 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom7-RA | 1..384 | 1..384 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom7-RB | 94..477 | 1..384 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8951688..8951892 | 1..205 | 100 | -> | Plus |
2R | 8952002..8952180 | 206..384 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8951688..8951892 | 1..205 | 100 | -> | Plus |
2R | 8952002..8952180 | 206..384 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8951688..8951892 | 1..205 | 100 | -> | Plus |
2R | 8952002..8952180 | 206..384 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 4839507..4839685 | 206..384 | 99 | Plus | |
arm_2R | 4839193..4839397 | 1..205 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8952887..8953091 | 1..205 | 100 | -> | Plus |
2R | 8953201..8953379 | 206..384 | 99 | Plus |
Translation from 105 to 269
> AT23266.hyp MKLSEGVKDRLGFVVGVVQTGFHWGFVPLVLYLGFMKGAEPGMPPLNLFS LLWQ*
Translation from 105 to 269
> AT23266.pep MKLSEGVKDRLGFVVGVVQTGFHWGFVPLVLYLGFMKGAEPGMPPLNLFS LLWQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12220-PA | 54 | GF12220-PA | 1..54 | 1..54 | 228 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23401-PA | 54 | GG23401-PA | 1..54 | 1..54 | 252 | 90.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21631-PA | 54 | GH21631-PA | 1..54 | 1..54 | 218 | 77.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tom7-PB | 54 | CG8226-PB | 1..54 | 1..54 | 291 | 100 | Plus |
Tom7-PA | 54 | CG8226-PA | 1..54 | 1..54 | 291 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20086-PA | 54 | GI20086-PA | 1..54 | 1..54 | 175 | 75.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11011-PA | 54 | GL11011-PA | 1..54 | 1..54 | 202 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20911-PA | 54 | GA20911-PA | 1..54 | 1..54 | 202 | 83.3 | Plus |
Dpse\GA25350-PA | 61 | GA25350-PA | 9..59 | 2..52 | 170 | 60.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21083-PA | 54 | GM21083-PA | 1..54 | 1..54 | 256 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10619-PA | 54 | GD10619-PA | 1..54 | 1..54 | 256 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21176-PA | 54 | GJ21176-PA | 1..54 | 1..54 | 176 | 77.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17988-PA | 54 | GK17988-PA | 1..54 | 1..54 | 233 | 85.2 | Plus |
Dwil\GK12155-PA | 54 | GK12155-PA | 1..54 | 1..54 | 169 | 55.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19243-PA | 54 | GE19243-PA | 1..54 | 1..54 | 251 | 88.9 | Plus |