Clone AT23266 Report

Search the DGRC for AT23266

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:232
Well:66
Vector:pOTB7
Associated Gene/TranscriptTom7-RA
Protein status:AT23266.pep: gold
Sequenced Size:396

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8226 2001-12-17 Blastp of sequenced clone
CG8224 2002-01-01 Sim4 clustering to Release 2
CG8226 2003-01-01 Sim4 clustering to Release 3
Tom7 2008-04-29 Release 5.5 accounting
Tom7 2008-08-15 Release 5.9 accounting
Tom7 2008-12-18 5.12 accounting

Clone Sequence Records

AT23266.complete Sequence

396 bp (396 high quality bases) assembled on 2001-12-17

GenBank Submission: AY070812

> AT23266.complete
CTGTTTTATATCGAAAAAAGTGCTGTTTTCCAACACTTCGTTTGCAGTCA
GACAAGTTATCATTTCATAATTCGCAAAAGGAGCTAAATTCAATATCCGT
ACGAAATGAAGCTATCCGAGGGAGTTAAGGATCGTTTGGGATTTGTGGTT
GGAGTCGTCCAGACTGGATTCCACTGGGGATTCGTGCCTCTTGTGCTGTA
TTTGGGATTTATGAAGGGAGCTGAGCCTGGCATGCCGCCTCTGAACCTTT
TCAGTCTGTTATGGCAGTAAAAATAGTGGACATGATCATTTTGCTGTCGT
ATGCCCCGCATTTTGGTTCTGGTTGGGTTTCTGGGCACGGGTGCAGTACC
TGCAGCTATTGCAAATAAATATCTGTTACAAAACAAAAAAAAAAAA

AT23266.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
Tom7-RA 624 Tom7-RA 133..519 1..387 1920 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4839265..4839470 1..206 1030 100 Plus
chr2R 21145070 chr2R 4839578..4839757 205..384 900 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:57:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8951688..8951893 1..206 1030 100 Plus
2R 25286936 2R 8952001..8952183 205..387 900 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8952887..8953092 1..206 1030 100 Plus
2R 25260384 2R 8953200..8953382 205..387 900 99.4 Plus
Blast to na_te.dros performed on 2019-03-16 06:01:54 has no hits.

AT23266.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:02:44 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4839579..4839757 206..384 100   Plus
chr2R 4839265..4839469 1..205 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:18:54 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 1..165 106..270 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:24 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 1..165 106..270 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:23:44 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 1..165 106..270 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:57 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 1..165 106..270 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:13:33 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 1..165 106..270 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:46 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 1..384 1..384 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:24 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 1..384 1..384 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:44 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RB 94..477 1..384 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:57 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RA 1..384 1..384 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:13:33 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
Tom7-RB 94..477 1..384 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:44 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8951688..8951892 1..205 100 -> Plus
2R 8952002..8952180 206..384 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:44 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8951688..8951892 1..205 100 -> Plus
2R 8952002..8952180 206..384 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:44 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8951688..8951892 1..205 100 -> Plus
2R 8952002..8952180 206..384 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:44 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4839507..4839685 206..384 99   Plus
arm_2R 4839193..4839397 1..205 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:52 Download gff for AT23266.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8952887..8953091 1..205 100 -> Plus
2R 8953201..8953379 206..384 99   Plus

AT23266.hyp Sequence

Translation from 105 to 269

> AT23266.hyp
MKLSEGVKDRLGFVVGVVQTGFHWGFVPLVLYLGFMKGAEPGMPPLNLFS
LLWQ*

AT23266.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Tom7-PB 54 CG8226-PB 1..54 1..54 291 100 Plus
Tom7-PA 54 CG8226-PA 1..54 1..54 291 100 Plus

AT23266.pep Sequence

Translation from 105 to 269

> AT23266.pep
MKLSEGVKDRLGFVVGVVQTGFHWGFVPLVLYLGFMKGAEPGMPPLNLFS
LLWQ*

AT23266.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12220-PA 54 GF12220-PA 1..54 1..54 228 81.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23401-PA 54 GG23401-PA 1..54 1..54 252 90.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21631-PA 54 GH21631-PA 1..54 1..54 218 77.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
Tom7-PB 54 CG8226-PB 1..54 1..54 291 100 Plus
Tom7-PA 54 CG8226-PA 1..54 1..54 291 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20086-PA 54 GI20086-PA 1..54 1..54 175 75.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11011-PA 54 GL11011-PA 1..54 1..54 202 83.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20911-PA 54 GA20911-PA 1..54 1..54 202 83.3 Plus
Dpse\GA25350-PA 61 GA25350-PA 9..59 2..52 170 60.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21083-PA 54 GM21083-PA 1..54 1..54 256 92.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10619-PA 54 GD10619-PA 1..54 1..54 256 92.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21176-PA 54 GJ21176-PA 1..54 1..54 176 77.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17988-PA 54 GK17988-PA 1..54 1..54 233 85.2 Plus
Dwil\GK12155-PA 54 GK12155-PA 1..54 1..54 169 55.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19243-PA 54 GE19243-PA 1..54 1..54 251 88.9 Plus