Clone AT23443 Report

Search the DGRC for AT23443

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:234
Well:43
Vector:pOTB7
Associated Gene/TranscriptCG14763-RA
Protein status:AT23443.pep: gold
Preliminary Size:570
Sequenced Size:665

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14763 2001-12-16 Blastp of sequenced clone
CG14763 2002-01-01 Sim4 clustering to Release 2
CG14763 2003-01-01 Sim4 clustering to Release 3
CG14763 2008-04-29 Release 5.5 accounting
CG14763 2008-08-15 Release 5.9 accounting
CG14763 2008-12-18 5.12 accounting

Clone Sequence Records

AT23443.complete Sequence

665 bp (665 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070813

> AT23443.complete
GTTAAACATTGTGATCATGGGCGACTCACCGGAAGAGCGGCGCAGCAAGG
ATGTCGTGCCAGAGACCGCCGCCAAGGAGGCGGAAACTGGCAAGGGCAAA
AAGGAGAAGAAAGAAAAGTCGGCCGAGGGCACTAAGCCGAGGCCGGCAAG
CAGCCAGCGCGGATCGCTGACCAAGTCCCATATGGGCGTTTCCTTGCCGA
TGGGTGCTCCGGCAGCCAAGCCCACCATGCGGTTCATGCCCACCTACCGC
CTGGAGTCCAAGAATCCGCTCAACAAGGAACGCGTGGAGAACATCATAAA
GGCGGTGATGAACCGACACTACAACGATGAGTACATGTTCCATCCCAAGC
ATTCCCTCCACATGGCCGCGCAAGTGAGCGAGGAAATCAAGAACCGCATC
AAACTCGACAACTACGACAGATATCGCTACATAGTGCTGGTCACTGTGGG
CGAGTTCCTGATGCAGGGCCTCTACTCCATGGTCAACTTCCTGTGGGATG
CTGAAAAAGACGGATTTGTGACCTACAGCGTGGAGAGACCCTCGTACTTT
GCAGTCTGCACCACCTTTTACCTGTACTACGATTAAGAACGCGATTCCAG
GGCCCTGGCGCGTTCCACTTGGTAATAAAATTGATGTTGATGCTAGCAAA
AAAAAAAAAAAAAAA

AT23443.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG14763-RA 647 CG14763-RA 1..647 1..647 3235 100 Plus
CG14763.c 690 CG14763.c 1..621 1..621 3105 100 Plus
CG14763.a 690 CG14763.a 1..621 1..621 3105 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3854170..3854399 647..418 1150 100 Minus
chr2R 21145070 chr2R 3854451..3854656 420..215 1015 99.5 Minus
chr2R 21145070 chr2R 3855278..3855416 139..1 695 100 Minus
chr2R 21145070 chr2R 3854711..3854792 220..139 410 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:57:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7966776..7967007 649..418 1160 100 Minus
2R 25286936 2R 7967059..7967264 420..215 1015 99.5 Minus
2R 25286936 2R 7967886..7968024 139..1 695 100 Minus
2R 25286936 2R 7967319..7967400 220..139 410 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7967975..7968206 649..418 1160 100 Minus
2R 25260384 2R 7968258..7968463 420..215 1015 99.5 Minus
2R 25260384 2R 7969085..7969223 139..1 695 100 Minus
2R 25260384 2R 7968518..7968599 220..139 410 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:24:16 has no hits.

AT23443.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:24:53 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3854170..3854396 421..647 100 <- Minus
chr2R 3854451..3854650 221..420 100 <- Minus
chr2R 3854711..3854791 140..220 100 <- Minus
chr2R 3855278..3855416 1..139 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:19:08 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
CG14763-RA 1..570 17..586 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:17:31 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
CG14763-RA 1..570 17..586 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:40:56 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
CG14763-RA 1..570 17..586 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:08:43 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
CG14763-RA 1..570 17..586 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:33:18 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
CG14763-RA 1..570 17..586 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:41:56 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
CG14763-RA 1..647 1..647 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:17:31 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
CG14763-RA 1..647 1..647 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:40:56 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
CG14763-RA 1..647 1..647 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:08:43 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
CG14763-RA 1..647 1..647 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:33:18 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
CG14763-RA 1..647 1..647 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:53 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7966778..7967004 421..647 100 <- Minus
2R 7967059..7967258 221..420 100 <- Minus
2R 7967319..7967399 140..220 100 <- Minus
2R 7967886..7968024 1..139 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:53 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7966778..7967004 421..647 100 <- Minus
2R 7967059..7967258 221..420 100 <- Minus
2R 7967319..7967399 140..220 100 <- Minus
2R 7967886..7968024 1..139 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:53 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7966778..7967004 421..647 100 <- Minus
2R 7967059..7967258 221..420 100 <- Minus
2R 7967319..7967399 140..220 100 <- Minus
2R 7967886..7968024 1..139 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:40:56 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3854283..3854509 421..647 100 <- Minus
arm_2R 3854564..3854763 221..420 100 <- Minus
arm_2R 3854824..3854904 140..220 100 <- Minus
arm_2R 3855391..3855529 1..139 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:40:42 Download gff for AT23443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7969085..7969223 1..139 100   Minus
2R 7967977..7968203 421..647 100 <- Minus
2R 7968258..7968457 221..420 100 <- Minus
2R 7968518..7968598 140..220 100 <- Minus

AT23443.hyp Sequence

Translation from 1 to 585

> AT23443.hyp
LNIVIMGDSPEERRSKDVVPETAAKEAETGKGKKEKKEKSAEGTKPRPAS
SQRGSLTKSHMGVSLPMGAPAAKPTMRFMPTYRLESKNPLNKERVENIIK
AVMNRHYNDEYMFHPKHSLHMAAQVSEEIKNRIKLDNYDRYRYIVLVTVG
EFLMQGLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLYYD*

AT23443.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG14763-PC 189 CG14763-PC 1..189 6..194 993 100 Plus
CG14763-PB 189 CG14763-PB 1..189 6..194 993 100 Plus
CG14763-PA 189 CG14763-PA 1..189 6..194 993 100 Plus

AT23443.pep Sequence

Translation from 16 to 585

> AT23443.pep
MGDSPEERRSKDVVPETAAKEAETGKGKKEKKEKSAEGTKPRPASSQRGS
LTKSHMGVSLPMGAPAAKPTMRFMPTYRLESKNPLNKERVENIIKAVMNR
HYNDEYMFHPKHSLHMAAQVSEEIKNRIKLDNYDRYRYIVLVTVGEFLMQ
GLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLYYD*

AT23443.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11225-PA 195 GF11225-PA 1..195 1..189 767 78.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10691-PA 189 GG10691-PA 1..189 1..189 993 97.4 Plus
Dere\GG23256-PA 254 GG23256-PA 147..254 85..189 150 29.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16265-PA 182 GH16265-PA 1..182 1..189 545 55.6 Plus
Dgri\GH21281-PA 148 GH21281-PA 3..148 42..189 521 64.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG14763-PC 189 CG14763-PC 1..189 1..189 993 100 Plus
CG14763-PB 189 CG14763-PB 1..189 1..189 993 100 Plus
CG14763-PA 189 CG14763-PA 1..189 1..189 993 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19107-PA 167 GI19107-PA 23..167 42..189 545 66.9 Plus
Dmoj\GI13201-PA 179 GI13201-PA 1..179 1..189 506 53.4 Plus
Dmoj\GI19482-PA 185 GI19482-PA 78..185 85..189 139 29.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10607-PA 198 GL10607-PA 51..198 42..189 662 83.9 Plus
Dper\GL11151-PA 173 GL11151-PA 66..173 85..189 137 29.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13230-PA 198 GA13230-PA 1..198 1..189 661 67.2 Plus
Dpse\GA11842-PA 173 GA11842-PA 66..173 85..189 138 29.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20739-PA 189 GM20739-PA 1..189 1..189 1015 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10204-PA 183 GD10204-PA 1..183 1..189 937 94.2 Plus
Dsim\GD10456-PA 261 GD10456-PA 154..261 85..189 149 29.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22236-PA 147 GJ22236-PA 3..147 42..189 550 65.5 Plus
Dvir\GJ11978-PA 185 GJ11978-PA 1..185 1..189 534 57.1 Plus
Dvir\GJ15142-PA 201 GJ15142-PA 94..201 85..189 146 29.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10636-PA 207 GK10636-PA 30..207 6..189 632 64.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23443-PA 189 GE23443-PA 1..189 1..189 983 96.8 Plus
Dyak\GE19106-PA 205 GE19106-PA 98..205 85..189 146 29.6 Plus