Clone AT23551 Report

Search the DGRC for AT23551

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:235
Well:51
Vector:pOTB7
Associated Gene/TranscriptCG31740-RA
Protein status:AT23551.pep: gold
Sequenced Size:610

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15151 2002-01-01 Sim4 clustering to Release 2
CG31740 2002-01-18 Blastp of sequenced clone
CG31740 2003-01-01 Sim4 clustering to Release 3
CG31740 2008-04-29 Release 5.5 accounting
CG31740 2008-08-15 Release 5.9 accounting
CG31740 2008-12-18 5.12 accounting

Clone Sequence Records

AT23551.complete Sequence

610 bp (610 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089413

> AT23551.complete
CTTGGACTGAACACATCTCTTTCGTAAAATAAAACACAAAAAAAAACAAT
ATGAAAAATTGAACAAAAATTCTAAATTCGTAGCCAAGGATTAACTTCAA
CGTATTTCTTCAGCAGGAAAAAAAATCCCAGCCGTACCTTTTGAGCCCCT
CCTGCAGATTTTAGAAGAGATTCCAGTGTCCTTTACCAAATCCAAACTTT
CAAGATGGTTCTGATGCTTTGCTGCAGCTTCGATCCCTTCTACGTTGGAC
CCTGCCCACCCGGCTGCCTGGCTCCTTTGATGGGAGGAACTCCCTATTGC
GGATGTGGTCCCTGTGGAGGTTGCTGTAGTCCTTGCTGTGGTCCATGTGG
TCCTTGTGGTGGCTGCAGCTCGTGTCCTTGCGGCTGGTGAAGCGCCCGCT
ATCATAGGCATTAATACGGCAGCAAGCGGTAACAAGTCAATTTAAAGATC
AACCTTCTGGAAAAGACTGCTGGAGAAATATGTTGCTGTTCGAATTCCTT
TTTGCCTTGGCCGGGGCTAAACCAACTAAGCTCTCGTATACATAAAGAAT
TTTTATTATAAGCTGTTCAGTAATAAAATGAATTAAAGTACAAAAAAAAA
AAAAAAAAAA

AT23551.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-RA 771 CG31740-RA 181..771 1..591 2955 100 Plus
elfless-RB 1677 elfless-RB 1622..1677 595..540 280 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18007877..18008339 129..591 2315 100 Plus
chr2L 23010047 chr2L 18007613..18007743 1..131 655 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:57:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18009232..18009698 129..595 2335 100 Plus
2L 23513712 2L 18008968..18009098 1..131 655 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18009232..18009698 129..595 2335 100 Plus
2L 23513712 2L 18008968..18009098 1..131 655 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:02:04 has no hits.

AT23551.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:02:49 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18007613..18007743 1..131 100 -> Plus
chr2L 18007880..18008339 132..591 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:19:20 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 1..186 205..390 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:38 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 1..186 205..390 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:23:49 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 1..186 205..390 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:10 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 1..186 205..390 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:13:46 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 1..186 205..390 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:07:35 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 41..631 1..591 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:38 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 181..771 1..591 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:49 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 16..606 1..591 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:10 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 41..631 1..591 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:13:46 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
CG31740-RA 16..606 1..591 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:49 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18008968..18009098 1..131 100 -> Plus
2L 18009235..18009694 132..591 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:49 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18008968..18009098 1..131 100 -> Plus
2L 18009235..18009694 132..591 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:49 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18008968..18009098 1..131 100 -> Plus
2L 18009235..18009694 132..591 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:49 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18008968..18009098 1..131 100 -> Plus
arm_2L 18009235..18009694 132..591 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:56 Download gff for AT23551.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18009235..18009694 132..591 100   Plus
2L 18008968..18009098 1..131 100 -> Plus

AT23551.pep Sequence

Translation from 204 to 389

> AT23551.pep
MVLMLCCSFDPFYVGPCPPGCLAPLMGGTPYCGCGPCGGCCSPCCGPCGP
CGGCSSCPCGW*

AT23551.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21101-PA 58 GG21101-PA 1..58 1..61 243 95.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-PA 61 CG31740-PA 1..61 1..61 406 100 Plus
Mst87F-PB 56 CG17956-PB 1..53 5..61 152 49.2 Plus
Mst87F-PA 56 CG17956-PA 1..53 5..61 152 49.2 Plus
Mst84Db-PA 74 CG17934-PA 1..59 5..60 150 49.2 Plus
Mst98Cb-PA 265 CG18396-PA 208..259 15..61 150 55.8 Plus
Mst84Dd-PA 72 CG17935-PA 14..56 15..54 149 60 Plus
Mst84Da-PA 63 CG17946-PA 16..60 21..60 141 55.6 Plus
Mst84Dd-PA 72 CG17935-PA 3..54 17..60 137 54.5 Plus
Mst98Cb-PA 265 CG18396-PA 174..250 11..60 137 42.9 Plus
Mst84Db-PA 74 CG17934-PA 23..68 15..59 132 53.1 Plus
Mst84Dc-PB 55 CG17945-PB 3..37 34..60 131 65.7 Plus
Mst84Dc-PA 55 CG17945-PA 3..37 34..60 131 65.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17258-PA 61 GM17258-PA 1..61 1..61 268 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24123-PA 61 GD24123-PA 1..61 1..61 268 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12805-PA 58 GE12805-PA 1..58 1..61 243 95.1 Plus

AT23551.hyp Sequence

Translation from 204 to 389

> AT23551.hyp
MVLMLCCSFDPFYVGPCPPGCLAPLMGGTPYCGCGPCGGCCSPCCGPCGP
CGGCSSCPCGW*

AT23551.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG31740-PA 61 CG31740-PA 1..61 1..61 406 100 Plus
Mst87F-PB 56 CG17956-PB 1..53 5..61 152 49.2 Plus
Mst87F-PA 56 CG17956-PA 1..53 5..61 152 49.2 Plus
Mst84Db-PA 74 CG17934-PA 1..59 5..60 150 49.2 Plus
Mst84Dd-PA 72 CG17935-PA 14..56 15..54 149 60 Plus
Mst84Db-PA 74 CG17934-PA 23..68 15..59 132 53.1 Plus