AT23551.complete Sequence
610 bp (610 high quality bases) assembled on 2002-01-18
GenBank Submission: AY089413
> AT23551.complete
CTTGGACTGAACACATCTCTTTCGTAAAATAAAACACAAAAAAAAACAAT
ATGAAAAATTGAACAAAAATTCTAAATTCGTAGCCAAGGATTAACTTCAA
CGTATTTCTTCAGCAGGAAAAAAAATCCCAGCCGTACCTTTTGAGCCCCT
CCTGCAGATTTTAGAAGAGATTCCAGTGTCCTTTACCAAATCCAAACTTT
CAAGATGGTTCTGATGCTTTGCTGCAGCTTCGATCCCTTCTACGTTGGAC
CCTGCCCACCCGGCTGCCTGGCTCCTTTGATGGGAGGAACTCCCTATTGC
GGATGTGGTCCCTGTGGAGGTTGCTGTAGTCCTTGCTGTGGTCCATGTGG
TCCTTGTGGTGGCTGCAGCTCGTGTCCTTGCGGCTGGTGAAGCGCCCGCT
ATCATAGGCATTAATACGGCAGCAAGCGGTAACAAGTCAATTTAAAGATC
AACCTTCTGGAAAAGACTGCTGGAGAAATATGTTGCTGTTCGAATTCCTT
TTTGCCTTGGCCGGGGCTAAACCAACTAAGCTCTCGTATACATAAAGAAT
TTTTATTATAAGCTGTTCAGTAATAAAATGAATTAAAGTACAAAAAAAAA
AAAAAAAAAA
AT23551.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:56:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-RA | 771 | CG31740-RA | 181..771 | 1..591 | 2955 | 100 | Plus |
elfless-RB | 1677 | elfless-RB | 1622..1677 | 595..540 | 280 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:02:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 18007877..18008339 | 129..591 | 2315 | 100 | Plus |
chr2L | 23010047 | chr2L | 18007613..18007743 | 1..131 | 655 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:57:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18009232..18009698 | 129..595 | 2335 | 100 | Plus |
2L | 23513712 | 2L | 18008968..18009098 | 1..131 | 655 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18009232..18009698 | 129..595 | 2335 | 100 | Plus |
2L | 23513712 | 2L | 18008968..18009098 | 1..131 | 655 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 06:02:04 has no hits.
AT23551.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:02:49 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 18007613..18007743 | 1..131 | 100 | -> | Plus |
chr2L | 18007880..18008339 | 132..591 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:19:20 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 1..186 | 205..390 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:38 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 1..186 | 205..390 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:23:49 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 1..186 | 205..390 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:10 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 1..186 | 205..390 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:13:46 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 1..186 | 205..390 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:07:35 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 41..631 | 1..591 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:38 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 181..771 | 1..591 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:49 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 16..606 | 1..591 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:10 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 41..631 | 1..591 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:13:46 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31740-RA | 16..606 | 1..591 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:49 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18008968..18009098 | 1..131 | 100 | -> | Plus |
2L | 18009235..18009694 | 132..591 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:49 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18008968..18009098 | 1..131 | 100 | -> | Plus |
2L | 18009235..18009694 | 132..591 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:49 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18008968..18009098 | 1..131 | 100 | -> | Plus |
2L | 18009235..18009694 | 132..591 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:49 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18008968..18009098 | 1..131 | 100 | -> | Plus |
arm_2L | 18009235..18009694 | 132..591 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:56 Download gff for
AT23551.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18009235..18009694 | 132..591 | 100 | | Plus |
2L | 18008968..18009098 | 1..131 | 100 | -> | Plus |
AT23551.pep Sequence
Translation from 204 to 389
> AT23551.pep
MVLMLCCSFDPFYVGPCPPGCLAPLMGGTPYCGCGPCGGCCSPCCGPCGP
CGGCSSCPCGW*
AT23551.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:10:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG21101-PA | 58 | GG21101-PA | 1..58 | 1..61 | 243 | 95.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-PA | 61 | CG31740-PA | 1..61 | 1..61 | 406 | 100 | Plus |
Mst87F-PB | 56 | CG17956-PB | 1..53 | 5..61 | 152 | 49.2 | Plus |
Mst87F-PA | 56 | CG17956-PA | 1..53 | 5..61 | 152 | 49.2 | Plus |
Mst84Db-PA | 74 | CG17934-PA | 1..59 | 5..60 | 150 | 49.2 | Plus |
Mst98Cb-PA | 265 | CG18396-PA | 208..259 | 15..61 | 150 | 55.8 | Plus |
Mst84Dd-PA | 72 | CG17935-PA | 14..56 | 15..54 | 149 | 60 | Plus |
Mst84Da-PA | 63 | CG17946-PA | 16..60 | 21..60 | 141 | 55.6 | Plus |
Mst84Dd-PA | 72 | CG17935-PA | 3..54 | 17..60 | 137 | 54.5 | Plus |
Mst98Cb-PA | 265 | CG18396-PA | 174..250 | 11..60 | 137 | 42.9 | Plus |
Mst84Db-PA | 74 | CG17934-PA | 23..68 | 15..59 | 132 | 53.1 | Plus |
Mst84Dc-PB | 55 | CG17945-PB | 3..37 | 34..60 | 131 | 65.7 | Plus |
Mst84Dc-PA | 55 | CG17945-PA | 3..37 | 34..60 | 131 | 65.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:10:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM17258-PA | 61 | GM17258-PA | 1..61 | 1..61 | 268 | 100 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:10:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD24123-PA | 61 | GD24123-PA | 1..61 | 1..61 | 268 | 100 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:10:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12805-PA | 58 | GE12805-PA | 1..58 | 1..61 | 243 | 95.1 | Plus |
AT23551.hyp Sequence
Translation from 204 to 389
> AT23551.hyp
MVLMLCCSFDPFYVGPCPPGCLAPLMGGTPYCGCGPCGGCCSPCCGPCGP
CGGCSSCPCGW*
AT23551.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:12:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31740-PA | 61 | CG31740-PA | 1..61 | 1..61 | 406 | 100 | Plus |
Mst87F-PB | 56 | CG17956-PB | 1..53 | 5..61 | 152 | 49.2 | Plus |
Mst87F-PA | 56 | CG17956-PA | 1..53 | 5..61 | 152 | 49.2 | Plus |
Mst84Db-PA | 74 | CG17934-PA | 1..59 | 5..60 | 150 | 49.2 | Plus |
Mst84Dd-PA | 72 | CG17935-PA | 14..56 | 15..54 | 149 | 60 | Plus |
Mst84Db-PA | 74 | CG17934-PA | 23..68 | 15..59 | 132 | 53.1 | Plus |