Clone AT24116 Report

Search the DGRC for AT24116

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:241
Well:16
Vector:pOTB7
Associated Gene/TranscriptCG11106-RA
Protein status:AT24116.pep: gold
Preliminary Size:577
Sequenced Size:539

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11106 2001-12-16 Blastp of sequenced clone
CG11106 2002-01-01 Sim4 clustering to Release 2
CG11106 2003-01-01 Sim4 clustering to Release 3
CG11106 2008-04-29 Release 5.5 accounting
CG11106 2008-08-15 Release 5.9 accounting
CG11106 2008-12-18 5.12 accounting

Clone Sequence Records

AT24116.complete Sequence

539 bp (539 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070814

> AT24116.complete
CCAAATTCCAAATAAAATTTTTTATAAAAACAAAAAAAAAAACAGTTCGT
AAATATTTCCGATTCCGTACAAATTTTTGAGCATCATGGTGTGGAATACG
CTTTCCTTCTGGGACGGTCAACCAGTCACTTCCCCGGTATATCCCCGGAT
GGGGGATATGTGGAACCCCAATACCGCCGGCTACCAGAATTACCAACACC
CTCAGAACCATTCGCATAGCAATTACTTTCAACGGATGGGCATGGGTGAC
ATTCGCCAGATGAGCTGTCCCATGCCGAACTACTGTCCTCAATTCCGGGA
GCCCGGATTGGACGATGTGGATGCCTTTTACGCTTACAACGGCATGGATA
TAACTCAGGCCTACGGCGGTGGATCTGGAGCTGGTCACGGAGCAGGATCT
GGAGCGCGGGGCGACTTTTGGTAGTAACTCGTCAACCAATACCTGGCGTA
TGCTTCTTAATTTTCTGTGCGTTTGATATATGGAACTATTAAAATGTTTT
ATTGAATAGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT24116.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG11106-RA 539 CG11106-RA 29..539 1..511 2555 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:47:34
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11093520..11094029 1..510 2550 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:57:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11202297..11202808 1..512 2560 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11210395..11210906 1..512 2560 100 Plus
Blast to na_te.dros performed 2019-03-16 22:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 785..826 3..44 129 78.6 Plus

AT24116.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:48:29 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11093520..11094029 1..510 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:19:41 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
CG11106-RA 1..339 86..424 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:57:58 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
CG11106-RA 1..339 86..424 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:13:25 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
CG11106-RA 1..339 86..424 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:38:48 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
CG11106-RA 1..339 86..424 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:42:54 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
CG11106-RA 1..339 86..424 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:37:51 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
CG11106-RA 29..538 1..510 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:57:58 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
CG11106-RA 29..538 1..510 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:13:25 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
CG11106-RA 50..559 1..510 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:38:48 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
CG11106-RA 29..538 1..510 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:42:54 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
CG11106-RA 50..559 1..510 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:29 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
X 11202297..11202806 1..510 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:29 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
X 11202297..11202806 1..510 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:29 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
X 11202297..11202806 1..510 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:13:25 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11096330..11096839 1..510 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:25 Download gff for AT24116.complete
Subject Subject Range Query Range Percent Splice Strand
X 11210395..11210904 1..510 100   Plus

AT24116.hyp Sequence

Translation from 85 to 423

> AT24116.hyp
MVWNTLSFWDGQPVTSPVYPRMGDMWNPNTAGYQNYQHPQNHSHSNYFQR
MGMGDIRQMSCPMPNYCPQFREPGLDDVDAFYAYNGMDITQAYGGGSGAG
HGAGSGARGDFW*

AT24116.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11106-PB 112 CG11106-PB 1..112 1..112 653 100 Plus
CG11106-PA 112 CG11106-PA 1..112 1..112 653 100 Plus
CG15200-PA 113 CG15200-PA 3..113 4..112 139 31.5 Plus

AT24116.pep Sequence

Translation from 85 to 423

> AT24116.pep
MVWNTLSFWDGQPVTSPVYPRMGDMWNPNTAGYQNYQHPQNHSHSNYFQR
MGMGDIRQMSCPMPNYCPQFREPGLDDVDAFYAYNGMDITQAYGGGSGAG
HGAGSGARGDFW*

AT24116.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:39:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22588-PA 139 GF22588-PA 5..116 6..90 155 37.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:39:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18400-PA 113 GG18400-PA 1..89 1..89 421 86.5 Plus
Dere\GG18398-PA 117 GG18398-PA 3..117 4..112 166 39.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG11106-PB 112 CG11106-PB 1..112 1..112 653 100 Plus
CG11106-PA 112 CG11106-PA 1..112 1..112 653 100 Plus
CG15200-PA 113 CG15200-PA 3..113 4..112 139 31.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11465-PA 112 GM11465-PA 1..112 1..112 531 86.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17009-PA 112 GD17009-PA 1..112 1..112 534 87.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15916-PA 120 GE15916-PA 1..120 1..112 413 79.2 Plus