AT24116.complete Sequence
539 bp (539 high quality bases) assembled on 2001-12-16
GenBank Submission: AY070814
> AT24116.complete
CCAAATTCCAAATAAAATTTTTTATAAAAACAAAAAAAAAAACAGTTCGT
AAATATTTCCGATTCCGTACAAATTTTTGAGCATCATGGTGTGGAATACG
CTTTCCTTCTGGGACGGTCAACCAGTCACTTCCCCGGTATATCCCCGGAT
GGGGGATATGTGGAACCCCAATACCGCCGGCTACCAGAATTACCAACACC
CTCAGAACCATTCGCATAGCAATTACTTTCAACGGATGGGCATGGGTGAC
ATTCGCCAGATGAGCTGTCCCATGCCGAACTACTGTCCTCAATTCCGGGA
GCCCGGATTGGACGATGTGGATGCCTTTTACGCTTACAACGGCATGGATA
TAACTCAGGCCTACGGCGGTGGATCTGGAGCTGGTCACGGAGCAGGATCT
GGAGCGCGGGGCGACTTTTGGTAGTAACTCGTCAACCAATACCTGGCGTA
TGCTTCTTAATTTTCTGTGCGTTTGATATATGGAACTATTAAAATGTTTT
ATTGAATAGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AT24116.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:34:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11106-RA | 539 | CG11106-RA | 29..539 | 1..511 | 2555 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:47:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 11093520..11094029 | 1..510 | 2550 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:57:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:47:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 11202297..11202808 | 1..512 | 2560 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 11210395..11210906 | 1..512 | 2560 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 22:47:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\Tom | 7060 | Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). | 785..826 | 3..44 | 129 | 78.6 | Plus |
AT24116.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:48:29 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 11093520..11094029 | 1..510 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:19:41 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11106-RA | 1..339 | 86..424 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:57:58 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11106-RA | 1..339 | 86..424 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:13:25 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11106-RA | 1..339 | 86..424 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:38:48 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11106-RA | 1..339 | 86..424 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:42:54 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11106-RA | 1..339 | 86..424 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:37:51 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11106-RA | 29..538 | 1..510 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:57:58 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11106-RA | 29..538 | 1..510 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:13:25 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11106-RA | 50..559 | 1..510 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:38:48 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11106-RA | 29..538 | 1..510 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:42:54 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11106-RA | 50..559 | 1..510 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:29 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 11202297..11202806 | 1..510 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:29 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 11202297..11202806 | 1..510 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:29 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 11202297..11202806 | 1..510 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:13:25 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 11096330..11096839 | 1..510 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:25 Download gff for
AT24116.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 11210395..11210904 | 1..510 | 100 | | Plus |
AT24116.hyp Sequence
Translation from 85 to 423
> AT24116.hyp
MVWNTLSFWDGQPVTSPVYPRMGDMWNPNTAGYQNYQHPQNHSHSNYFQR
MGMGDIRQMSCPMPNYCPQFREPGLDDVDAFYAYNGMDITQAYGGGSGAG
HGAGSGARGDFW*
AT24116.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:13:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11106-PB | 112 | CG11106-PB | 1..112 | 1..112 | 653 | 100 | Plus |
CG11106-PA | 112 | CG11106-PA | 1..112 | 1..112 | 653 | 100 | Plus |
CG15200-PA | 113 | CG15200-PA | 3..113 | 4..112 | 139 | 31.5 | Plus |
AT24116.pep Sequence
Translation from 85 to 423
> AT24116.pep
MVWNTLSFWDGQPVTSPVYPRMGDMWNPNTAGYQNYQHPQNHSHSNYFQR
MGMGDIRQMSCPMPNYCPQFREPGLDDVDAFYAYNGMDITQAYGGGSGAG
HGAGSGARGDFW*
AT24116.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:39:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF22588-PA | 139 | GF22588-PA | 5..116 | 6..90 | 155 | 37.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:39:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG18400-PA | 113 | GG18400-PA | 1..89 | 1..89 | 421 | 86.5 | Plus |
Dere\GG18398-PA | 117 | GG18398-PA | 3..117 | 4..112 | 166 | 39.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11106-PB | 112 | CG11106-PB | 1..112 | 1..112 | 653 | 100 | Plus |
CG11106-PA | 112 | CG11106-PA | 1..112 | 1..112 | 653 | 100 | Plus |
CG15200-PA | 113 | CG15200-PA | 3..113 | 4..112 | 139 | 31.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:39:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM11465-PA | 112 | GM11465-PA | 1..112 | 1..112 | 531 | 86.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:39:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD17009-PA | 112 | GD17009-PA | 1..112 | 1..112 | 534 | 87.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:39:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE15916-PA | 120 | GE15916-PA | 1..120 | 1..112 | 413 | 79.2 | Plus |