Clone AT24358 Report

Search the DGRC for AT24358

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:243
Well:58
Vector:pOTB7
Associated Gene/TranscriptCG15676-RA
Protein status:AT24358.pep: gold
Preliminary Size:492
Sequenced Size:647

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15676 2001-12-16 Blastp of sequenced clone
CG15676 2002-01-01 Sim4 clustering to Release 2
CG15676 2003-01-01 Sim4 clustering to Release 3
CG15676 2008-04-29 Release 5.5 accounting
CG15676 2008-08-15 Release 5.9 accounting
CG15676 2008-12-18 5.12 accounting

Clone Sequence Records

AT24358.complete Sequence

647 bp (647 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070815

> AT24358.complete
CAATTATTGAAAATGTTTGCATTCATAGACACCATAAAAAAGCCGCCTCT
GGGCGGCCGAAAGTCATTTATGCCCATCCCAGAGGCCAAGTTAGTTGACG
ATGTCGTCAGCTACATCGCCAAGCCAGAGTTCTATTCGACTGTTCCAGCG
GCATTGAAGATGCAACGCCTTTTCTATGTGCAATACAGCGAACTGGCTGC
CAAGTTGGAGACTGACCTCACAGCAGTGTTAACCCGTTTGGAGGCTGCCA
AAAATAATTTGGAATTGGTGAGGAGGTTCATAGACAATCCTGACAAGGAA
GTTCACAGCCTCGTGCAAATCGCACAGGGAGTATTCAGATGGGTGAGCAT
ACCGCCAGTGCAAAAGGTTACCCTTCAAGTGGGCGCATCTCTGCAAATGG
AATTCGAGCTGTCCGAGGCGGAGGAGTTCATCAAAAAGGACATCACCAGC
CTGGTGAAGCAGCAATTGCAACATGAGCACGATATCGACTATCTGCAGGA
TCAGGTGAACACGATTGAGATGAACCTAGCCGTATTGTATAAACATGAAG
TGGAGAACTAGAAGCATCCCACCATCCTTAAAATTGCTAGTACCTTGTAG
TTGCTTATAAAGACATTCGTTCTAAATAAAAAAAAAAAAAAAAAAAA

AT24358.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG15676-RA 646 CG15676-RA 18..646 1..629 3145 100 Plus
CG15676.a 593 CG15676.a 291..593 327..629 1515 100 Plus
CG15676.a 593 CG15676.a 25..292 1..268 1340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17558167..17558793 1..627 3135 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:57:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21671717..21672345 1..629 3145 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21672916..21673544 1..629 3145 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:02:48 has no hits.

AT24358.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:03:47 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17558167..17558793 1..627 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:19:56 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
CG15676-RA 1..549 13..561 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:04:39 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
CG15676-RA 1..549 13..561 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:40:09 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
CG15676-RA 1..549 13..561 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:54:53 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
CG15676-RA 1..549 13..561 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:08:29 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
CG15676-RA 1..549 13..561 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:23:57 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
CG15676-RA 18..644 1..627 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:04:39 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
CG15676-RA 18..644 1..627 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:40:09 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
CG15676-RA 18..644 1..627 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:54:53 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
CG15676-RA 18..644 1..627 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:08:29 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
CG15676-RA 18..644 1..627 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:47 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21671717..21672343 1..627 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:47 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21671717..21672343 1..627 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:47 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21671717..21672343 1..627 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:40:09 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17559222..17559848 1..627 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:27:11 Download gff for AT24358.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21672916..21673542 1..627 100   Plus

AT24358.hyp Sequence

Translation from 1 to 560

> AT24358.hyp
QLLKMFAFIDTIKKPPLGGRKSFMPIPEAKLVDDVVSYIAKPEFYSTVPA
ALKMQRLFYVQYSELAAKLETDLTAVLTRLEAAKNNLELVRRFIDNPDKE
VHSLVQIAQGVFRWVSIPPVQKVTLQVGASLQMEFELSEAEEFIKKDITS
LVKQQLQHEHDIDYLQDQVNTIEMNLAVLYKHEVEN*

AT24358.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG15676-PB 182 CG15676-PB 1..182 5..186 915 100 Plus
CG15676-PA 182 CG15676-PA 1..182 5..186 915 100 Plus
mgr-PA 194 CG6719-PA 1..180 5..185 209 28.6 Plus

AT24358.pep Sequence

Translation from 12 to 560

> AT24358.pep
MFAFIDTIKKPPLGGRKSFMPIPEAKLVDDVVSYIAKPEFYSTVPAALKM
QRLFYVQYSELAAKLETDLTAVLTRLEAAKNNLELVRRFIDNPDKEVHSL
VQIAQGVFRWVSIPPVQKVTLQVGASLQMEFELSEAEEFIKKDITSLVKQ
QLQHEHDIDYLQDQVNTIEMNLAVLYKHEVEN*

AT24358.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:07:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13259-PA 197 GF13259-PA 1..183 1..182 423 51.4 Plus
Dana\GF18161-PA 194 GF18161-PA 1..180 1..181 216 32.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:07:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22129-PA 182 GG22129-PA 1..180 1..180 805 82.8 Plus
Dere\GG17226-PA 194 GG17226-PA 1..180 1..181 206 31 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24010-PA 196 GH24010-PA 1..180 1..181 209 30.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG15676-PB 182 CG15676-PB 1..182 1..182 915 100 Plus
CG15676-PA 182 CG15676-PA 1..182 1..182 915 100 Plus
mgr-PA 194 CG6719-PA 1..180 1..181 209 28.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10062-PA 195 GI10062-PA 1..180 1..181 204 31 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12609-PA 195 GL12609-PA 1..180 1..181 202 29.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19809-PA 195 GA19809-PA 1..180 1..181 202 29.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15853-PA 182 GM15853-PA 1..182 1..182 883 91.2 Plus
Dsec\GM26102-PA 194 GM26102-PA 1..179 1..180 205 30.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11614-PA 182 GD11614-PA 1..182 1..182 901 92.9 Plus
Dsim\GD20662-PA 194 GD20662-PA 1..179 1..180 205 30.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23797-PA 195 GJ23797-PA 1..180 1..181 200 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19015-PA 192 GK19015-PA 1..178 1..178 341 39.1 Plus
Dwil\GK11798-PA 195 GK11798-PA 1..180 1..181 208 31.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24626-PA 194 GE24626-PA 1..179 1..180 216 32.2 Plus