BDGP Sequence Production Resources |
Search the DGRC for AT24358
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 243 |
Well: | 58 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG15676-RA |
Protein status: | AT24358.pep: gold |
Preliminary Size: | 492 |
Sequenced Size: | 647 |
Gene | Date | Evidence |
---|---|---|
CG15676 | 2001-12-16 | Blastp of sequenced clone |
CG15676 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15676 | 2003-01-01 | Sim4 clustering to Release 3 |
CG15676 | 2008-04-29 | Release 5.5 accounting |
CG15676 | 2008-08-15 | Release 5.9 accounting |
CG15676 | 2008-12-18 | 5.12 accounting |
647 bp (647 high quality bases) assembled on 2001-12-16
GenBank Submission: AY070815
> AT24358.complete CAATTATTGAAAATGTTTGCATTCATAGACACCATAAAAAAGCCGCCTCT GGGCGGCCGAAAGTCATTTATGCCCATCCCAGAGGCCAAGTTAGTTGACG ATGTCGTCAGCTACATCGCCAAGCCAGAGTTCTATTCGACTGTTCCAGCG GCATTGAAGATGCAACGCCTTTTCTATGTGCAATACAGCGAACTGGCTGC CAAGTTGGAGACTGACCTCACAGCAGTGTTAACCCGTTTGGAGGCTGCCA AAAATAATTTGGAATTGGTGAGGAGGTTCATAGACAATCCTGACAAGGAA GTTCACAGCCTCGTGCAAATCGCACAGGGAGTATTCAGATGGGTGAGCAT ACCGCCAGTGCAAAAGGTTACCCTTCAAGTGGGCGCATCTCTGCAAATGG AATTCGAGCTGTCCGAGGCGGAGGAGTTCATCAAAAAGGACATCACCAGC CTGGTGAAGCAGCAATTGCAACATGAGCACGATATCGACTATCTGCAGGA TCAGGTGAACACGATTGAGATGAACCTAGCCGTATTGTATAAACATGAAG TGGAGAACTAGAAGCATCCCACCATCCTTAAAATTGCTAGTACCTTGTAG TTGCTTATAAAGACATTCGTTCTAAATAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 17558167..17558793 | 1..627 | 3135 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 21671717..21672345 | 1..629 | 3145 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 21672916..21673544 | 1..629 | 3145 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 17558167..17558793 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15676-RA | 1..549 | 13..561 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15676-RA | 1..549 | 13..561 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15676-RA | 1..549 | 13..561 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15676-RA | 1..549 | 13..561 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15676-RA | 1..549 | 13..561 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15676-RA | 18..644 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15676-RA | 18..644 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15676-RA | 18..644 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15676-RA | 18..644 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15676-RA | 18..644 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21671717..21672343 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21671717..21672343 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21671717..21672343 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 17559222..17559848 | 1..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21672916..21673542 | 1..627 | 100 | Plus |
Translation from 1 to 560
> AT24358.hyp QLLKMFAFIDTIKKPPLGGRKSFMPIPEAKLVDDVVSYIAKPEFYSTVPA ALKMQRLFYVQYSELAAKLETDLTAVLTRLEAAKNNLELVRRFIDNPDKE VHSLVQIAQGVFRWVSIPPVQKVTLQVGASLQMEFELSEAEEFIKKDITS LVKQQLQHEHDIDYLQDQVNTIEMNLAVLYKHEVEN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15676-PB | 182 | CG15676-PB | 1..182 | 5..186 | 915 | 100 | Plus |
CG15676-PA | 182 | CG15676-PA | 1..182 | 5..186 | 915 | 100 | Plus |
mgr-PA | 194 | CG6719-PA | 1..180 | 5..185 | 209 | 28.6 | Plus |
Translation from 12 to 560
> AT24358.pep MFAFIDTIKKPPLGGRKSFMPIPEAKLVDDVVSYIAKPEFYSTVPAALKM QRLFYVQYSELAAKLETDLTAVLTRLEAAKNNLELVRRFIDNPDKEVHSL VQIAQGVFRWVSIPPVQKVTLQVGASLQMEFELSEAEEFIKKDITSLVKQ QLQHEHDIDYLQDQVNTIEMNLAVLYKHEVEN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13259-PA | 197 | GF13259-PA | 1..183 | 1..182 | 423 | 51.4 | Plus |
Dana\GF18161-PA | 194 | GF18161-PA | 1..180 | 1..181 | 216 | 32.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22129-PA | 182 | GG22129-PA | 1..180 | 1..180 | 805 | 82.8 | Plus |
Dere\GG17226-PA | 194 | GG17226-PA | 1..180 | 1..181 | 206 | 31 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24010-PA | 196 | GH24010-PA | 1..180 | 1..181 | 209 | 30.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15676-PB | 182 | CG15676-PB | 1..182 | 1..182 | 915 | 100 | Plus |
CG15676-PA | 182 | CG15676-PA | 1..182 | 1..182 | 915 | 100 | Plus |
mgr-PA | 194 | CG6719-PA | 1..180 | 1..181 | 209 | 28.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10062-PA | 195 | GI10062-PA | 1..180 | 1..181 | 204 | 31 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12609-PA | 195 | GL12609-PA | 1..180 | 1..181 | 202 | 29.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19809-PA | 195 | GA19809-PA | 1..180 | 1..181 | 202 | 29.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15853-PA | 182 | GM15853-PA | 1..182 | 1..182 | 883 | 91.2 | Plus |
Dsec\GM26102-PA | 194 | GM26102-PA | 1..179 | 1..180 | 205 | 30.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11614-PA | 182 | GD11614-PA | 1..182 | 1..182 | 901 | 92.9 | Plus |
Dsim\GD20662-PA | 194 | GD20662-PA | 1..179 | 1..180 | 205 | 30.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23797-PA | 195 | GJ23797-PA | 1..180 | 1..181 | 200 | 30.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19015-PA | 192 | GK19015-PA | 1..178 | 1..178 | 341 | 39.1 | Plus |
Dwil\GK11798-PA | 195 | GK11798-PA | 1..180 | 1..181 | 208 | 31.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24626-PA | 194 | GE24626-PA | 1..179 | 1..180 | 216 | 32.2 | Plus |