Clone AT24369 Report

Search the DGRC for AT24369

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:243
Well:69
Vector:pOTB7
Associated Gene/TranscriptCG14013-RA
Protein status:AT24369.pep: gold
Preliminary Size:859
Sequenced Size:963

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14013 2003-01-01 Sim4 clustering to Release 3
CG14013 2004-01-09 Blastp of sequenced clone
CG14013 2008-04-29 Release 5.5 accounting
CG14013 2008-08-15 Release 5.9 accounting
CG14013 2008-12-18 5.12 accounting

Clone Sequence Records

AT24369.complete Sequence

963 bp (963 high quality bases) assembled on 2004-01-09

GenBank Submission: BT011401

> AT24369.complete
CAAACACACACTCTTTTAAATATAACACTTACACATTAAAAGGGACTTTT
TCCTGAACCACAAAGAGGAGCAGGAACCTGCTCTTGGCTGAAGTCCATCC
ACACCACACAGCAGTAGGACTAAGATGGCCACCCAGGGAAAGAGCGTGGA
CTTTAGCGTATTGGAGTTTGACAATTACAATGACTACATCTCCTCGTTTG
CCACCGTCACGGACCACAGATATCTGGGCAATCAAAACACGATCAAGACC
ATCGTCCAGCTGGGTTACCGCACCACCAAGATACCCTACACAGCCGAAGA
GTATGAGAAGAGGGTTGACCTGGCCCTGGAGGCCATTAGGCCGAAGCTGG
CACACGTGGGCCTGTTCAGCGACCTCCTGTCGCCGACGAACAGGGACCCA
GTTCTTCTGGAGTTCAAGGCCCGCGAGCTGCTCAACTTGAACAAGATACT
ATCGACCATCGTTTTTACCTCGTACATCCACATGGACGGCTCGGAGATCT
CCGGCTACATAGACCTGGACATGAGCTGGCGCAACTGCTTCCGCGAGGCA
ATCAAGCACACGGACTGGCGGGGAGTCTTCCAAGGTCGCTCTCGCCTGAA
GCCCATGCCACACCATCTCAGCTACTCGAATCCCCGGTATAACGTGGTCA
AGTACACGGATAGCGATAACTACCAGGTGATGCACGACCATCACTTCGGA
CTGATGTTCATGCATCGCGGTGACCACAAAATGATTTCGGTGGGCGGCCA
GTTCAACATTTACTCGAGGAACGCCAAGCGATCGATGGTCTACTCTCCCA
AGTTCGGGTATGTTGTGTTCTACGATCACTTTGTCCGCAAGAAGGTATAG
AACGTGGAGATGGGATAAGTCGGTATCAAAATTGTAAATATAGAAAGTGT
AATGTTCATATAAAAGCAGAAACTATTAAAAAGTAAAATTGCATAAAAAA
AAAAAAAAAAAAA

AT24369.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG14013-RA 964 CG14013-RA 12..958 1..947 4675 99.5 Plus
CG14013.a 918 CG14013.a 12..466 1..455 2260 99.7 Plus
CG14013.a 918 CG14013.a 465..916 496..947 2215 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5551941..5552431 944..454 2410 99.4 Minus
chr2L 23010047 chr2L 5552484..5552937 454..1 2255 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:57:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5552840..5553333 947..454 2425 99.4 Minus
2L 23513712 2L 5553386..5553839 454..1 2255 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5552840..5553333 947..454 2425 99.3 Minus
2L 23513712 2L 5553386..5553839 454..1 2255 99.7 Minus
Blast to na_te.dros performed on 2019-03-16 22:50:47 has no hits.

AT24369.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:51:54 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5551941..5552430 455..944 99 <- Minus
chr2L 5552484..5552937 1..454 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:19:58 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
CG14013-RA 1..726 125..850 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:43:46 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
CG14013-RA 1..726 125..850 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:13:46 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
CG14013-RA 1..726 125..850 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:32:34 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
CG14013-RA 1..726 125..850 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:43:32 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
CG14013-RA 1..726 125..850 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:54:07 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
CG14013-RA 10..953 1..944 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:43:46 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
CG14013-RA 10..953 1..944 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:13:46 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
CG14013-RA 12..955 1..944 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:32:37 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
CG14013-RA 10..953 1..944 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:43:32 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
CG14013-RA 12..955 1..944 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:51:54 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5552843..5553332 455..944 99 <- Minus
2L 5553386..5553839 1..454 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:51:54 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5552843..5553332 455..944 99 <- Minus
2L 5553386..5553839 1..454 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:51:54 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5552843..5553332 455..944 99 <- Minus
2L 5553386..5553839 1..454 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:13:46 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5552843..5553332 455..944 99 <- Minus
arm_2L 5553386..5553839 1..454 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:05:13 Download gff for AT24369.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5552843..5553332 455..944 99 <- Minus
2L 5553386..5553839 1..454 99   Minus

AT24369.hyp Sequence

Translation from 124 to 849

> AT24369.hyp
MATQGKSVDFSVLEFDNYNDYISSFATVTDHRYLGNQNTIKTIVQLGYRT
TKIPYTAEEYEKRVDLALEAIRPKLAHVGLFSDLLSPTNRDPVLLEFKAR
ELLNLNKILSTIVFTSYIHMDGSEISGYIDLDMSWRNCFREAIKHTDWRG
VFQGRSRLKPMPHHLSYSNPRYNVVKYTDSDNYQVMHDHHFGLMFMHRGD
HKMISVGGQFNIYSRNAKRSMVYSPKFGYVVFYDHFVRKKV*

AT24369.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14013-PA 241 CG14013-PA 1..241 1..241 1283 100 Plus
CG8138-PA 233 CG8138-PA 3..232 9..240 392 36.6 Plus
CG3528-PA 235 CG3528-PA 2..233 11..239 384 35.5 Plus
CG14017-PA 238 CG14017-PA 26..238 18..241 317 37.1 Plus

AT24369.pep Sequence

Translation from 124 to 849

> AT24369.pep
MATQGKSVDFSVLEFDNYNDYISSFATVTDHRYLGNQNTIKTIVQLGYRT
TKIPYTAEEYEKRVDLALEAIRPKLAHVGLFSDLLSPTNRDPVLLEFKAR
ELLNLNKILSTIVFTSYIHMDGSEISGYIDLDMSWRNCFREAIKHTDWRG
VFQGRSRLKPMPHHLSYSNPRYNVVKYTDSDNYQVMHDHHFGLMFMHRGD
HKMISVGGQFNIYSRNAKRSMVYSPKFGYVVFYDHFVRKKV*

AT24369.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14314-PA 240 GF14314-PA 3..240 4..241 1128 86.6 Plus
Dana\GF20603-PA 235 GF20603-PA 4..233 13..239 403 39.7 Plus
Dana\GF17583-PA 233 GF17583-PA 2..233 8..241 401 36.8 Plus
Dana\GF15571-PA 282 GF15571-PA 65..282 13..241 256 30.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24295-PA 241 GG24295-PA 1..241 1..241 1216 92.1 Plus
Dere\GG24513-PA 235 GG24513-PA 2..233 11..239 396 35.9 Plus
Dere\GG19478-PA 233 GG19478-PA 2..233 8..241 391 36.8 Plus
Dere\GG25082-PA 245 GG25082-PA 33..245 18..241 275 33.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10702-PA 239 GH10702-PA 4..239 6..241 741 57.6 Plus
Dgri\GH13001-PA 233 GH13001-PA 4..231 9..239 409 39.4 Plus
Dgri\GH11496-PA 235 GH11496-PA 2..233 11..239 338 34.6 Plus
Dgri\GH13002-PA 169 GH13002-PA 20..169 89..241 299 40.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14013-PA 241 CG14013-PA 1..241 1..241 1283 100 Plus
CG8138-PA 233 CG8138-PA 3..232 9..240 392 36.6 Plus
CG3528-PA 235 CG3528-PA 2..233 11..239 384 35.5 Plus
CG14017-PA 238 CG14017-PA 26..238 18..241 317 37.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11263-PA 239 GI11263-PA 4..239 6..241 706 54.7 Plus
Dmoj\GI17674-PA 235 GI17674-PA 1..233 1..239 409 38.1 Plus
Dmoj\GI10061-PA 256 GI10061-PA 4..203 7..209 348 37.9 Plus
Dmoj\GI17675-PA 229 GI17675-PA 4..227 7..239 315 35.5 Plus
Dmoj\GI16993-PA 229 GI16993-PA 2..227 11..239 307 34.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26647-PA 238 GL26647-PA 6..238 8..241 891 70.9 Plus
Dper\GL26464-PA 236 GL26464-PA 2..234 11..239 398 41.3 Plus
Dper\GL24395-PA 233 GL24395-PA 3..232 9..240 375 35.3 Plus
Dper\GL26367-PA 223 GL26367-PA 4..222 11..240 287 32.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29003-PA 238 GA29003-PA 6..238 8..241 894 71.4 Plus
Dpse\GA17502-PA 236 GA17502-PA 2..234 11..239 398 41.3 Plus
Dpse\GA20845-PA 233 GA20845-PA 3..232 9..240 374 34.9 Plus
Dpse\GA12701-PA 223 GA12701-PA 4..222 11..240 282 31.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18012-PA 241 GM18012-PA 1..241 1..241 1262 97.1 Plus
Dsec\GM24088-PA 233 GM24088-PA 2..233 8..241 384 36.3 Plus
Dsec\GM18221-PA 309 GM18221-PA 2..201 11..208 310 35.6 Plus
Dsec\GM18558-PA 129 GM18558-PA 1..129 111..241 219 41.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22646-PA 109 GD22646-PA 1..109 133..241 593 98.2 Plus
Dsim\GD18886-PA 233 GD18886-PA 2..233 8..241 392 36.3 Plus
Dsim\GD22828-PA 235 GD22828-PA 2..233 11..239 375 35.5 Plus
Dsim\GD23351-PA 238 GD23351-PA 26..238 18..241 298 37.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12400-PA 239 GJ12400-PA 4..239 6..241 758 57.2 Plus
Dvir\GJ18363-PA 227 GJ18363-PA 1..227 8..238 397 37.2 Plus
Dvir\GJ17870-PA 234 GJ17870-PA 4..232 7..239 387 37.8 Plus
Dvir\GJ17871-PA 338 GJ17871-PA 6..200 9..206 349 41 Plus
Dvir\GJ24171-PA 217 GJ24171-PA 2..215 11..239 262 29.5 Plus
Dvir\GJ17871-PA 338 GJ17871-PA 210..338 110..241 217 38.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15432-PA 242 GK15432-PA 2..242 1..241 945 71.4 Plus
Dwil\GK16731-PA 233 GK16731-PA 3..233 9..241 382 37.3 Plus
Dwil\GK23733-PA 236 GK23733-PA 3..234 12..239 347 36.1 Plus
Dwil\GK16455-PA 236 GK16455-PA 2..227 4..235 320 33.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18991-PA 241 GE18991-PA 1..241 1..241 1217 93.4 Plus
Dyak\GE26250-PA 233 GE26250-PA 2..233 8..241 388 36.8 Plus
Dyak\GE15089-PA 235 GE15089-PA 2..233 11..239 372 36.3 Plus
Dyak\GE25504-PA 229 GE25504-PA 17..229 18..241 276 33.5 Plus