Clone AT24389 Report

Search the DGRC for AT24389

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:243
Well:89
Vector:pOTB7
Associated Gene/TranscriptCG11739-RA
Protein status:AT24389.pep: gold
Preliminary Size:1286
Sequenced Size:1316

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11739 2002-01-01 Sim4 clustering to Release 2
CG11739 2002-02-22 Blastp of sequenced clone
CG11739 2003-01-01 Sim4 clustering to Release 3
CG11739 2008-04-29 Release 5.5 accounting
CG11739 2008-08-15 Release 5.9 accounting
CG11739 2008-12-18 5.12 accounting

Clone Sequence Records

AT24389.complete Sequence

1316 bp (1316 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089419

> AT24389.complete
GTTACATATGGGATAAAAAGGCGAAAGCAAAAAGGAGCCGACAAAAGTTA
TTTAATATTTTAAAGGGCAATCATGAGCCCTCTCCCACGAGTCAACATCG
ACGAGCCGAAATATGATCAGAACTCCTACTTGGGCAGAGCCAAGCACTTC
TTCCTGCTGACCAACCCGCTTAATGTGCTGGCCTCCGCCTCGAAGTTGGA
GGAGGCCCGCCAGATTGTGATAAAGTACCGGGCTGGCAAGGATGTTCCCG
AGTGCAAGACCATCGACGACGTGTGGCGCGCTAAGTACCTGTACGATTCG
GCGTTCCATCCAGAGACCGGGGAGAAGCAGATAGTCATCGGGCGCATGGC
TGCGCAGATGCCCATGAACACAATCATCACCGGCGGCATGATGGCCTTCT
ACAAAAGCACTCCCGCCGTCGTCTTCTGGCAGTGGTTCAATCAGACATTC
AACGCCATTGTTAACTACACGAACCGTTCGGGAACCTCGCCCATCAGCCA
GCAGCAACTAGTTACCTCGTACTGTTTGGCCACTAGCGGAGCCCTGGTCA
CGGCCCTTTCCCTGAACCACGCAGTGAAGAACATGAATCCGCTCTTGGGT
CGCCTTGTCCCCCTAGTGGCAGTTGGAGCTGCCAACTGCATCAACATCCC
CTGCATGCGAATGCAAGAGCTGCGCAACGGAGTGACGCTTTTCGATGAAC
ACAGCAACGAAATGGGCATCTCAAAGAAGGCGGCCGTTGTTGGGATCTCA
ACCGTAATCCTAAGTCGAATCGCCATGGCCATACCGGGAATGACACTGAC
ACCGGTGTTGATGAATGTCCTCGAAAAGAGGGGATTCCTGGCTAAATACC
CGCGATCCAACGCTCCCATCCAAACGCTCTTCTGCGGCTTCGTGCTGATT
TTCGCCACGCCCCTTGGCTGCGCCTTCTTCAAGCAGCGAGCGGACATCAA
AGTGGATAGCCTGGAGTCGGAGGTCCGCGACAGCATTAGGAAGAAGCGTC
CGGAATTGGAAACTGTCTGGTTCAACAAGGGACTGTGAGGCCCTATGCCA
TTTACGAGCTTAACGGAGACAATACTGCTCGATTGAGCAACTATTTATTT
CCCTTCTTGCATTTATTGGCATTTTGCCTGTTGACTTCTGTTCGAAATAC
TCCTGATATTAGCCTGACCGCATATGCTTACCGTTCACAGCAAGCGACAC
GTCAGTGAATCAAATTTACAGTGTATATTATAGTGATTGTGTAAAAGTGA
AAATGTATGAAACAAAAATATATCTGTTAACTGTTAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAA

AT24389.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG11739-RC 1304 CG11739-RC 4..1289 1..1286 6430 100 Plus
CG11739-RD 1683 CG11739-RD 360..1584 62..1286 6110 99.9 Plus
CG11739-RA 1683 CG11739-RA 360..1584 62..1286 6110 99.9 Plus
CG11739-RD 1683 CG11739-RD 19..85 1..67 335 100 Plus
CG11739-RA 1683 CG11739-RA 19..85 1..67 335 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 206422..206913 794..1285 2460 100 Plus
chr3R 27901430 chr3R 205168..205342 66..240 860 99.4 Plus
chr3R 27901430 chr3R 205828..205989 504..665 810 100 Plus
chr3R 27901430 chr3R 205393..205544 235..386 760 100 Plus
chr3R 27901430 chr3R 206223..206350 666..793 640 100 Plus
chr3R 27901430 chr3R 205646..205765 385..504 600 100 Plus
chr3R 27901430 chr3R 204383..204449 1..67 335 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:57:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4380703..4381195 794..1286 2465 100 Plus
3R 32079331 3R 4379449..4379623 66..240 860 99.4 Plus
3R 32079331 3R 4380109..4380270 504..665 810 100 Plus
3R 32079331 3R 4379674..4379825 235..386 760 100 Plus
3R 32079331 3R 4380504..4380631 666..793 640 100 Plus
3R 32079331 3R 4379927..4380046 385..504 600 100 Plus
3R 32079331 3R 4378664..4378730 1..67 335 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4121534..4122026 794..1286 2465 100 Plus
3R 31820162 3R 4120280..4120454 66..240 860 99.4 Plus
3R 31820162 3R 4120940..4121101 504..665 810 100 Plus
3R 31820162 3R 4120505..4120656 235..386 760 100 Plus
3R 31820162 3R 4121335..4121462 666..793 640 100 Plus
3R 31820162 3R 4120758..4120877 385..504 600 100 Plus
3R 31820162 3R 4119495..4119561 1..67 335 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:43:54 has no hits.

AT24389.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:44:32 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 206223..206350 666..793 100 -> Plus
chr3R 204383..204448 1..66 100 -> Plus
chr3R 205169..205337 67..235 100 -> Plus
chr3R 205394..205543 236..385 100 -> Plus
chr3R 205647..205764 386..503 100 -> Plus
chr3R 205828..205989 504..665 100 -> Plus
chr3R 206422..206913 794..1285 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:20:00 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
CG11739-RD 1..966 73..1038 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:41:07 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
CG11739-RD 1..966 73..1038 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:58:18 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
CG11739-RA 1..966 73..1038 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:10:26 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
CG11739-RD 1..966 73..1038 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:13:03 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
CG11739-RA 1..966 73..1038 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:05:58 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
CG11739-RC 1..1285 1..1285 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:41:07 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
CG11739-RC 1..1285 1..1285 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:58:18 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
CG11739-RC 65..1349 1..1285 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:10:26 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
CG11739-RC 1..1285 1..1285 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:13:03 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
CG11739-RC 65..1349 1..1285 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:44:32 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4380109..4380270 504..665 100 -> Plus
3R 4380504..4380631 666..793 100 -> Plus
3R 4378664..4378729 1..66 100 -> Plus
3R 4379450..4379618 67..235 100 -> Plus
3R 4379675..4379824 236..385 100 -> Plus
3R 4379928..4380045 386..503 100 -> Plus
3R 4380703..4381194 794..1285 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:44:32 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4380109..4380270 504..665 100 -> Plus
3R 4380504..4380631 666..793 100 -> Plus
3R 4378664..4378729 1..66 100 -> Plus
3R 4379450..4379618 67..235 100 -> Plus
3R 4379675..4379824 236..385 100 -> Plus
3R 4379928..4380045 386..503 100 -> Plus
3R 4380703..4381194 794..1285 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:44:32 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4380109..4380270 504..665 100 -> Plus
3R 4380504..4380631 666..793 100 -> Plus
3R 4378664..4378729 1..66 100 -> Plus
3R 4379450..4379618 67..235 100 -> Plus
3R 4379675..4379824 236..385 100 -> Plus
3R 4379928..4380045 386..503 100 -> Plus
3R 4380703..4381194 794..1285 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:58:18 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 204386..204451 1..66 100 -> Plus
arm_3R 205172..205340 67..235 100 -> Plus
arm_3R 205397..205546 236..385 100 -> Plus
arm_3R 205650..205767 386..503 100 -> Plus
arm_3R 205831..205992 504..665 100 -> Plus
arm_3R 206226..206353 666..793 100 -> Plus
arm_3R 206425..206916 794..1285 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:44:46 Download gff for AT24389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4121534..4122025 794..1285 100   Plus
3R 4119495..4119560 1..66 100 -> Plus
3R 4120281..4120449 67..235 100 -> Plus
3R 4120506..4120655 236..385 100 -> Plus
3R 4120759..4120876 386..503 100 -> Plus
3R 4120940..4121101 504..665 100 -> Plus
3R 4121335..4121462 666..793 100 -> Plus

AT24389.pep Sequence

Translation from 72 to 1037

> AT24389.pep
MSPLPRVNIDEPKYDQNSYLGRAKHFFLLTNPLNVLASASKLEEARQIVI
KYRAGKDVPECKTIDDVWRAKYLYDSAFHPETGEKQIVIGRMAAQMPMNT
IITGGMMAFYKSTPAVVFWQWFNQTFNAIVNYTNRSGTSPISQQQLVTSY
CLATSGALVTALSLNHAVKNMNPLLGRLVPLVAVGAANCINIPCMRMQEL
RNGVTLFDEHSNEMGISKKAAVVGISTVILSRIAMAIPGMTLTPVLMNVL
EKRGFLAKYPRSNAPIQTLFCGFVLIFATPLGCAFFKQRADIKVDSLESE
VRDSIRKKRPELETVWFNKGL*

AT24389.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18208-PA 321 GF18208-PA 1..321 1..321 1476 82.9 Plus
Dana\GF16265-PA 321 GF16265-PA 3..310 4..311 1173 69.8 Plus
Dana\GF23658-PA 327 GF23658-PA 8..327 7..321 608 41.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12340-PA 321 GG12340-PA 1..321 1..321 1691 97.2 Plus
Dere\GG16020-PA 335 GG16020-PA 8..335 7..321 598 41.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18870-PA 321 GH18870-PA 1..321 1..321 1445 80.1 Plus
Dgri\GH14609-PA 327 GH14609-PA 8..327 7..321 629 43.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Sfxn1-3-PB 321 CG11739-PB 1..321 1..321 1657 100 Plus
Sfxn1-3-PD 321 CG11739-PD 1..321 1..321 1657 100 Plus
Sfxn1-3-PA 321 CG11739-PA 1..321 1..321 1657 100 Plus
Sfxn1-3-PC 321 CG11739-PC 1..321 1..321 1657 100 Plus
Sfxn2-PA 327 CG6812-PA 8..327 7..321 641 43 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24728-PA 321 GI24728-PA 1..321 1..321 1389 76.9 Plus
Dmoj\GI13497-PA 330 GI13497-PA 7..330 7..321 636 45.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10589-PA 321 GL10589-PA 1..321 1..321 1470 81.6 Plus
Dper\GL21459-PA 321 GL21459-PA 1..321 1..321 1468 81.6 Plus
Dper\GL21744-PA 333 GL21744-PA 6..333 7..321 639 42.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26276-PC 321 GA26276-PC 1..321 1..321 1468 81.6 Plus
Dpse\GA26276-PB 321 GA26276-PB 1..321 1..321 1468 81.6 Plus
Dpse\GA26276-PA 321 GA26276-PA 1..321 1..321 1468 81.6 Plus
Dpse\GA24416-PA 538 GA24416-PA 233..538 21..321 916 59.7 Plus
Dpse\GA19877-PA 333 GA19877-PA 6..333 7..321 639 42.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10749-PA 321 GM10749-PA 1..321 1..321 1725 99.7 Plus
Dsec\GM15009-PA 327 GM15009-PA 8..327 7..321 626 43 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19721-PA 321 GD19721-PA 1..321 1..321 1725 99.7 Plus
Dsim\GD14786-PA 327 GD14786-PA 8..327 7..321 617 42.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14554-PA 321 GJ14554-PA 1..321 1..321 1456 80.7 Plus
Dvir\GJ11858-PA 331 GJ11858-PA 14..331 14..321 604 43.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13527-PA 321 GK13527-PA 1..321 1..321 1434 80.1 Plus
Dwil\GK10400-PA 331 GK10400-PA 7..331 4..321 663 42.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25411-PA 321 GE25411-PA 1..321 1..321 1672 96 Plus
Dyak\GE19584-PA 327 GE19584-PA 8..327 7..321 619 42.7 Plus
Dyak\GE23187-PA 292 GE23187-PA 8..292 7..321 508 38 Plus

AT24389.hyp Sequence

Translation from 72 to 1037

> AT24389.hyp
MSPLPRVNIDEPKYDQNSYLGRAKHFFLLTNPLNVLASASKLEEARQIVI
KYRAGKDVPECKTIDDVWRAKYLYDSAFHPETGEKQIVIGRMAAQMPMNT
IITGGMMAFYKSTPAVVFWQWFNQTFNAIVNYTNRSGTSPISQQQLVTSY
CLATSGALVTALSLNHAVKNMNPLLGRLVPLVAVGAANCINIPCMRMQEL
RNGVTLFDEHSNEMGISKKAAVVGISTVILSRIAMAIPGMTLTPVLMNVL
EKRGFLAKYPRSNAPIQTLFCGFVLIFATPLGCAFFKQRADIKVDSLESE
VRDSIRKKRPELETVWFNKGL*

AT24389.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG11739-PB 321 CG11739-PB 1..321 1..321 1657 100 Plus
CG11739-PD 321 CG11739-PD 1..321 1..321 1657 100 Plus
CG11739-PA 321 CG11739-PA 1..321 1..321 1657 100 Plus
CG11739-PC 321 CG11739-PC 1..321 1..321 1657 100 Plus
CG6812-PA 327 CG6812-PA 8..327 7..321 641 43 Plus