Clone AT24563 Report

Search the DGRC for AT24563

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:245
Well:63
Vector:pOTB7
Associated Gene/Transcriptelfless-RA
Protein status:AT24563.pep: validated full length
Preliminary Size:564
Sequenced Size:1194

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15150 2002-01-01 Sim4 clustering to Release 2
CG15150 2002-04-26 Blastp of sequenced clone
CG15150 2003-01-01 Sim4 clustering to Release 3
elfless 2008-04-29 Release 5.5 accounting
elfless 2008-08-15 Release 5.9 accounting
elfless 2008-12-18 5.12 accounting

Clone Sequence Records

AT24563.complete Sequence

1194 bp (1194 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113298

> AT24563.complete
CTCAGTTACCTGGTGGGACTTCAAATGGAAAACTTCAGGACCTCGAATAA
TTCTGGAGTATCACAGCGAATCCATAACACCGGGCCCACTCCCGTACTCG
CGCCCTCCGGATTAAGATCCCGCTTACTCAGCGGTTCCTCTGAGCGGAAT
CCAAATGAGTATTACGGAGACTCGGACTCCTCAAGCAGCAGCAGATCTAT
CGACAGAACCCCATTCCTGTTGGAGTATTCCAGCGACTCAGAGTCGTCTA
GTTCCAGTGATAGTGAAAGCTCATCGACCAGCATTAGCTTCGATAGCAGT
ATGAGCTCCACCGAATCATCAACACCAATGGGACATACAGAATCCTCAGA
TTCAAACGAGGATTCTCCTCCCAACAAACGGATCAAATCAGATGACGAGG
AGTCCAAGAAATCTGTCTTGCCCTACAACTGCCCTGTGTGCCTGGAAGAT
GTCCGCGAGAAGCTACCAGTGTCCACCAATTGTGGCCACGTTTTCTGCAA
AGCGTGCATTAAGAGAGCTGTCGACACTGGCAGGGTATGCCCATTGTGCG
GAGTGGATGAGCCCGAATTCCATCGTATTTTCTTGTAAGACGTGATATGG
CAGAAAGCATACTAAACTAAAAATACCACGGTTTTAAATACCACAAATAG
ACTTGTGGCATATACTTTCGAAAGACCGTAACACAATATTCACACCTAAA
GAAACTGTTGCTCCATTATAACAACGCAAACAAAATCTTATCCCAGGCAA
CATACTCAAGAAACACAATGCAATCGAAAACTTTCAGCTGAGAAACTAAA
ACTCAAATACAAGACAGACAACTTTGGCCATAAAACATGGCGCAAGGACA
CACTCGCATACTTGCAGGAAACCCCGGAAAAATGGAAGGCAAGCAATGAA
AATTCCGACCTACCGCAATAAATTCCGCGGAAAAACAAAGCAAGTGATGC
CAAAATAAGAGTGAAATGGCCAGCTCACACACACACATGAATGTAAATGA
AGTGGAATCACCACCTCAGAAAAAGTCAGGGACACCTCAGACACGGCCCT
GTAAATCGCGCTTATCCAAAACACAACATGGCATCAGGAGGCATTGGAGA
TTCAGTTTCATTTTCATTCAAAGATTGAATAATAGAAGGGGGTGTTCCAT
CCCTACCCCAACAACCTTTGACCTGAAAAAAAAAAAAAAAAAAA

AT24563.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
elfless-RB 1677 elfless-RB 236..1411 1..1176 5865 99.9 Plus
elfless-RC 1411 elfless-RC 236..1411 1..1176 5865 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18008555..18009511 1175..219 4755 99.8 Minus
chr2L 23010047 chr2L 18009722..18009852 142..12 640 99.2 Minus
chr2L 23010047 chr2L 18009579..18009656 219..142 390 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:57:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18009909..18010866 1176..219 4775 99.9 Minus
2L 23513712 2L 18011077..18011207 142..12 655 100 Minus
2L 23513712 2L 18010934..18011011 219..142 390 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18009909..18010866 1176..219 4775 99.8 Minus
2L 23513712 2L 18011077..18011207 142..12 655 100 Minus
2L 23513712 2L 18010934..18011011 219..142 390 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:04:03 has no hits.

AT24563.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:04:41 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18008555..18009510 220..1175 99 <- Minus
chr2L 18009579..18009656 142..219 100 <- Minus
chr2L 18009723..18009854 7..141 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:20:23 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RA 1..564 25..588 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:56:38 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RC 103..690 1..588 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:22 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RB 103..690 1..588 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:00 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RA 1..564 25..588 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:15:01 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RB 103..690 1..588 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:36:14 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RA 1..1166 11..1175 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:56:38 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RC 202..1376 1..1175 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:22 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RB 202..1376 1..1175 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:00 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RA 1..1166 11..1175 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:15:01 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RB 202..1376 1..1175 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:41 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18011078..18011209 7..141 97   Minus
2L 18009910..18010865 220..1175 99 <- Minus
2L 18010934..18011011 142..219 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:41 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18011078..18011209 7..141 97   Minus
2L 18009910..18010865 220..1175 99 <- Minus
2L 18010934..18011011 142..219 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:41 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18011078..18011209 7..141 97   Minus
2L 18009910..18010865 220..1175 99 <- Minus
2L 18010934..18011011 142..219 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:22 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18009910..18010865 220..1175 99 <- Minus
arm_2L 18010934..18011011 142..219 100 <- Minus
arm_2L 18011078..18011209 7..141 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:21:51 Download gff for AT24563.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18009910..18010865 220..1175 99 <- Minus
2L 18010934..18011011 142..219 100 <- Minus
2L 18011078..18011209 7..141 97   Minus

AT24563.pep Sequence

Translation from 24 to 587

> AT24563.pep
MENFRTSNNSGVSQRIHNTGPTPVLAPSGLRSRLLSGSSERNPNEYYGDS
DSSSSSRSIDRTPFLLEYSSDSESSSSSDSESSSTSISFDSSMSSTESST
PMGHTESSDSNEDSPPNKRIKSDDEESKKSVLPYNCPVCLEDVREKLPVS
TNCGHVFCKACIKRAVDTGRVCPLCGVDEPEFHRIFL*

AT24563.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16357-PA 202 GF16357-PA 122..202 105..187 185 42.4 Plus
Dana\GF14677-PA 326 GF14677-PA 246..326 107..187 185 43.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21725-PA 192 GG21725-PA 105..192 93..187 295 60 Plus
Dere\GG13065-PA 320 GG13065-PA 242..320 109..187 162 42 Plus
Dere\GG22477-PA 94 GG22477-PA 38..80 133..175 134 51.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22295-PA 202 GH22295-PA 146..202 133..187 157 49.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
elfless-PC 229 CG15150-PC 43..229 1..187 974 100 Plus
elfless-PB 229 CG15150-PB 43..229 1..187 974 100 Plus
dgrn-PD 205 CG10981-PD 127..205 109..187 182 44.4 Plus
dgrn-PB 312 CG10981-PB 234..312 109..187 182 44.4 Plus
dgrn-PA 319 CG10981-PA 241..319 109..187 182 44.4 Plus
CG43058-PA 100 CG43058-PA 30..100 116..187 168 43.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:34:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14783-PA 374 GI14783-PA 319..360 134..175 161 59.5 Plus
Dmoj\GI21991-PA 294 GI21991-PA 239..294 134..187 159 51.8 Plus
Dmoj\GI13656-PA 254 GI13656-PA 198..254 133..187 154 49.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24328-PA 317 GL24328-PA 245..317 114..187 150 42.1 Plus
Dper\GL24317-PA 151 GL24317-PA 82..137 118..175 142 44.8 Plus
Dper\GL20345-PA 117 GL20345-PA 62..107 134..179 136 45.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25529-PA 128 GA25529-PA 9..128 70..187 172 35.5 Plus
Dpse\GA26569-PA 209 GA26569-PA 140..195 118..175 158 46.6 Plus
Dpse\GA28705-PA 209 GA28705-PA 140..195 118..175 151 44.8 Plus
Dpse\GA28704-PA 209 GA28704-PA 140..195 118..175 151 44.8 Plus
Dpse\GA28682-PA 138 GA28682-PA 69..124 118..175 149 44.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10845-PA 329 GM10845-PA 256..329 114..187 173 47.4 Plus
Dsec\GM20261-PA 167 GM20261-PA 32..87 118..175 154 43.1 Plus
Dsec\GM17105-PA 97 GM17105-PA 9..67 8..71 152 56.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19827-PA 329 GD19827-PA 256..329 114..187 172 47.4 Plus
Dsim\GD17803-PA 157 GD17803-PA 10..61 9..60 170 69.2 Plus
Dsim\GD25747-PA 101 GD25747-PA 45..101 133..187 156 45.6 Plus
Dsim\GD22545-PA 91 GD22545-PA 21..91 110..187 137 35.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13990-PA 303 GJ13990-PA 227..303 113..187 159 40.3 Plus
Dvir\GJ18825-PA 288 GJ18825-PA 233..284 134..186 155 54.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14441-PA 207 GK14441-PA 152..207 134..187 158 46.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13114-PA 239 GE13114-PA 45..239 1..187 350 51.9 Plus
Dyak\GE10170-PA 344 GE10170-PA 268..344 112..187 172 42.3 Plus
Dyak\GE13346-PA 230 GE13346-PA 174..230 133..187 146 45.6 Plus

AT24563.hyp Sequence

Translation from 24 to 587

> AT24563.hyp
MENFRTSNNSGVSQRIHNTGPTPVLAPSGLRSRLLSGSSERNPNEYYGDS
DSSSSSRSIDRTPFLLEYSSDSESSSSSDSESSSTSISFDSSMSSTESST
PMGHTESSDSNEDSPPNKRIKSDDEESKKSVLPYNCPVCLEDVREKLPVS
TNCGHVFCKACIKRAVDTGRVCPLCGVDEPEFHRIFL*

AT24563.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:14:05
Subject Length Description Subject Range Query Range Score Percent Strand
elfless-PC 229 CG15150-PC 43..229 1..187 974 100 Plus
elfless-PB 229 CG15150-PB 43..229 1..187 974 100 Plus
dgrn-PD 205 CG10981-PD 127..205 109..187 182 44.4 Plus
dgrn-PB 312 CG10981-PB 234..312 109..187 182 44.4 Plus
dgrn-PA 319 CG10981-PA 241..319 109..187 182 44.4 Plus