Clone AT24654 Report

Search the DGRC for AT24654

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:246
Well:54
Vector:pOTB7
Associated Gene/TranscriptCG33189-RA
Protein status:AT24654.pep: gold
Sequenced Size:705

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33189 2003-01-01 Sim4 clustering to Release 3
CG33189 2004-09-29 Blastp of sequenced clone
CG33189 2008-04-29 Release 5.5 accounting
CG33189 2008-08-15 Release 5.9 accounting
CG33189 2008-12-18 5.12 accounting

Clone Sequence Records

AT24654.complete Sequence

705 bp (705 high quality bases) assembled on 2004-09-29

GenBank Submission: BT016142

> AT24654.complete
ATCAGATTAATCCAAATTGTTTAAACGTTGAGCATTATGATTGGCGAGTT
TGAGGACTTAGACATCTTTTATGACTGCCGCAGTGACGACGAGGAGACTC
CAGATCTGGAAGTGGGCGGTGGTGATGAAGTGATCTGCAAGCAAGCGCCT
CGATTTGACGATCCTGTCCAGATTCGGGCCGTTTTGGAGCGGGCAGCCAC
TGCCACCCAGCGGTTGCTAAGGTGCTACGGAGGCACTGATTCCGTGCCAA
CTCGTCCTTTGATGACACTTTTCTATCCGGCCACCCTGGAGGTCAGTGCC
CGTCTACATACGGACGACAAGTGTCCTTGCCCCAAGGACAGGCAGTGCAA
GTTAATCGGCGACCCAGTGACCCTGAGGCTGCCAATCGAACTGAATCCGG
AAAGCGGCCAGGTCAAAGTCAACATCTTCCAGCCCAAGTCAATTGGCACA
TTTTGTGGATGCAATGCACCTGGAAATCAGAACAAGTCGAAGAGCAGAAG
ATCGAGTGTAAAGTGGTCCAACAAGGATGAAGTGTGTCCCGATTGCCAGG
AACCTAATCAAAACACGTAAATTTTAAACTTATCAAGAGCCACGTCTTGC
TCACTTAGTTGTTTTTTCTCAAAATTCATTGGTGACTAAATTGGATTATG
TTTGGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAA

AT24654.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG33189-RA 677 CG33189-RA 22..677 1..656 3280 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4606086..4606741 656..1 3280 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:58:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8780110..8780768 659..1 3295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8520941..8521599 659..1 3295 100 Minus
Blast to na_te.dros performed 2019-03-16 04:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
McClintock 6450 McClintock McCLINTOCK 6450bp 5652..5687 637..602 108 77.8 Minus

AT24654.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:57:40 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4606086..4606741 1..656 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:20:31 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
CG33189-RA 1..534 37..570 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:32:13 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
CG33189-RA 1..534 37..570 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:46:31 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
CG33189-RA 1..534 37..570 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:16:04 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
CG33189-RA 1..534 37..570 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:55:10 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
CG33189-RA 1..534 37..570 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:37:20 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
CG33189-RA 22..677 1..656 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:32:13 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
CG33189-RA 22..677 1..656 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:46:31 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
CG33189-RA 22..677 1..656 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:16:04 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
CG33189-RA 29..684 1..656 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:55:10 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
CG33189-RA 22..677 1..656 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:57:40 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8780113..8780768 1..656 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:57:40 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8780113..8780768 1..656 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:57:40 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8780113..8780768 1..656 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:46:31 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4605835..4606490 1..656 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:53:00 Download gff for AT24654.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8520944..8521599 1..656 100   Minus

AT24654.hyp Sequence

Translation from 36 to 569

> AT24654.hyp
MIGEFEDLDIFYDCRSDDEETPDLEVGGGDEVICKQAPRFDDPVQIRAVL
ERAATATQRLLRCYGGTDSVPTRPLMTLFYPATLEVSARLHTDDKCPCPK
DRQCKLIGDPVTLRLPIELNPESGQVKVNIFQPKSIGTFCGCNAPGNQNK
SKSRRSSVKWSNKDEVCPDCQEPNQNT*

AT24654.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG33189-PA 177 CG33189-PA 1..177 1..177 961 100 Plus
CG33191-PA 476 CG33191-PA 56..157 9..126 162 41 Plus

AT24654.pep Sequence

Translation from 36 to 569

> AT24654.pep
MIGEFEDLDIFYDCRSDDEETPDLEVGGGDEVICKQAPRFDDPVQIRAVL
ERAATATQRLLRCYGGTDSVPTRPLMTLFYPATLEVSARLHTDDKCPCPK
DRQCKLIGDPVTLRLPIELNPESGQVKVNIFQPKSIGTFCGCNAPGNQNK
SKSRRSSVKWSNKDEVCPDCQEPNQNT*

AT24654.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:07:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16832-PA 176 GF16832-PA 1..171 1..170 635 73.7 Plus
Dana\GF16833-PA 484 GF16833-PA 57..168 7..124 157 37.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:07:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17420-PA 177 GG17420-PA 1..177 1..177 866 91.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:07:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19336-PA 191 GH19336-PA 2..141 4..134 253 45.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG33189-PA 177 CG33189-PA 1..177 1..177 961 100 Plus
CG33191-PA 476 CG33191-PA 56..157 9..126 162 41 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes134-PA 203 GI23946-PA 3..150 9..144 238 41.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12127-PA 191 GL12127-PA 20..152 9..142 337 56.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:07:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17353-PA 191 GA17353-PA 20..152 9..142 342 56.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:07:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26310-PA 177 GM26310-PA 1..177 1..177 911 96.6 Plus
Dsec\GM26311-PA 231 GM26311-PA 56..157 9..126 166 42 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20842-PA 164 GD20842-PA 1..98 1..106 430 79.2 Plus
Dsim\GD20843-PA 476 GD20843-PA 56..157 9..126 165 42 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23735-PA 190 GJ23735-PA 3..144 9..135 274 43.7 Plus
Dvir\GJ23736-PA 520 GJ23736-PA 121..209 37..133 175 42.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11265-PA 187 GK11265-PA 5..185 9..166 357 47 Plus
Dwil\GK11264-PA 456 GK11264-PA 51..155 7..136 171 36.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24822-PA 177 GE24822-PA 1..177 1..177 888 93.8 Plus
Dyak\GE24823-PA 477 GE24823-PA 56..156 9..126 155 41.2 Plus