Clone AT24795 Report

Search the DGRC for AT24795

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:247
Well:95
Vector:pOTB7
Associated Gene/TranscriptCG9016-RA
Protein status:AT24795.pep: gold
Sequenced Size:729

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9016-RA 2009-01-21 est gleaning

Clone Sequence Records

AT24795.complete Sequence

729 bp assembled on 2009-01-22

GenBank Submission: BT057974.1

> AT24795.complete
GCTACACGGAAGTCCGTTCAGCAAAACAAAAAAAAAAAAAAAACACAATT
TTTTTTTTTATTAAAATTCAAAGGCCTAATATCATACAAAAGTGTCAGTG
AGCAGCATGGACGGCTTCTACAGCAACAGCAACAGTTGCAGCAACAACGG
CGGCTACTGCTCGCAGGGTTCGCGAAGTGGCAACTGCGGATCGTGTGGCA
ACTGCCCCGGTGGCCACTGCCCCCGAATGGAGGCGGGTGGTAGTAGCTAC
GGCGCTCGAGGAATGAGCCAGCCGGGTTGTCCTGGCGGCAACTGTTGTCC
CGGCGGAAGGTGTTCGGCCGGAAAGTCGCGCTTCAATCCAGACTGGCAGT
ATGGTGGACGCTAGCACCAAAGAGTTAGCGCTTCCCAGACCTGCAAATCG
AACGCCCACGAATGGACTTCCACTCCACATCTTACCGGAATAGCTGCACA
CAGGAATCAGATTAGGTGATCAGCATCGAGAGGAAGCGGATCCGCTGGTC
GACTCGGAAACTTGCACCCATATCCACACACTTACCATCTACACTTGCCA
TCTACACTTACCATCTACACTTACCATCTACACTTACCATCTACACTTAC
CATCTAGACTTACCATCTACACTTTCCACATACACTTTCCATTCACGCAT
AAATTACCAATATCCCCGACGAACAAGAAAATAAAAAGATACATACAAAT
GTAAAAATAAAGAAAAAAAAAAAAAAAAA

AT24795.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG9016-RA 841 CG9016-RA 42..746 1..705 3525 100 Plus
CG9016.c 2076 CG9016.c 16..720 1..705 3525 100 Plus
CG9016.a 684 CG9016.a 116..684 106..674 2845 100 Plus
CG9016.a 684 CG9016.a 16..113 1..98 490 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5921924..5922534 705..95 3055 100 Minus
chr2L 23010047 chr2L 5922585..5922682 98..1 490 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:58:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5922873..5923483 705..95 3055 100 Minus
2L 23513712 2L 5923534..5923631 98..1 490 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5922873..5923483 705..95 3055 100 Minus
2L 23513712 2L 5923534..5923631 98..1 490 100 Minus
Blast to na_te.dros performed 2019-03-16 15:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1104..1164 101..161 143 70.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2342..2412 86..160 140 69.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6744..6824 78..160 139 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6741..6824 101..187 130 64.4 Plus
roo 9092 roo DM_ROO 9092bp 1037..1130 60..160 129 62.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6779 101..160 129 68.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6798..6857 101..160 129 68.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2364..2424 87..148 127 69.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2362..2415 101..154 126 70.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2425..2485 101..161 125 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2605..2658 101..157 125 71.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6783..6836 101..154 117 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1528..1575 101..151 113 72.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6873..6923 101..151 111 68.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2297..2361 90..154 109 63.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2767..2883 101..217 107 56.8 Plus

AT24795.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:41:24 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5921924..5922530 99..705 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:45 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
CG9016-RB 1..258 107..364 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:33:14 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
CG9016-RB 1..258 107..364 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:15:52 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
CG9016-RA 1..258 107..364 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:46:16 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
CG9016-RA 1..258 107..364 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-22 13:21:13 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
CG9016-RA 16..689 1..674 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:33:14 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
CG9016-RA 16..689 1..674 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:15:52 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
CG9016-RA 23..724 1..702 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:46:16 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
CG9016-RA 23..724 1..702 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:24 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5922873..5923479 99..705 100 <- Minus
2L 5923534..5923631 1..98 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:24 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5922873..5923479 99..705 100 <- Minus
2L 5923534..5923631 1..98 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:24 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5922873..5923479 99..705 100 <- Minus
2L 5923534..5923631 1..98 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:15:52 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5922873..5923479 99..705 100 <- Minus
arm_2L 5923534..5923631 1..98 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:06:27 Download gff for AT24795.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5922873..5923479 99..705 100 <- Minus
2L 5923534..5923631 1..98 100   Minus

AT24795.pep Sequence

Translation from 106 to 363

> AT24795.pep
MDGFYSNSNSCSNNGGYCSQGSRSGNCGSCGNCPGGHCPRMEAGGSSYGA
RGMSQPGCPGGNCCPGGRCSAGKSRFNPDWQYGGR*

AT24795.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19670-PA 84 GF19670-PA 1..84 1..85 174 56.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24273-PA 85 GG24273-PA 1..85 1..85 261 73.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG9016-PB 85 CG9016-PB 1..85 1..85 511 100 Plus
CG9016-PA 85 CG9016-PA 1..85 1..85 511 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17987-PA 86 GM17987-PA 19..86 18..85 301 92.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22624-PA 86 GD22624-PA 19..86 18..85 305 92.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18970-PA 79 GE18970-PA 1..79 1..85 286 76.5 Plus

AT24795.hyp Sequence

Translation from 106 to 363

> AT24795.hyp
MDGFYSNSNSCSNNGGYCSQGSRSGNCGSCGNCPGGHCPRMEAGGSSYGA
RGMSQPGCPGGNCCPGGRCSAGKSRFNPDWQYGGR*

AT24795.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG9016-PB 85 CG9016-PB 1..85 1..85 511 100 Plus
CG9016-PA 85 CG9016-PA 1..85 1..85 511 100 Plus