Clone AT25266 Report

Search the DGRC for AT25266

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:252
Well:66
Vector:pOTB7
Associated Gene/TranscriptCG14305-RA
Protein status:AT25266.pep: gold
Preliminary Size:999
Sequenced Size:1299

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14305 2002-01-01 Sim4 clustering to Release 2
CG14305 2002-01-18 Blastp of sequenced clone
CG14305 2003-01-01 Sim4 clustering to Release 3
CG14305 2008-04-29 Release 5.5 accounting
CG14305 2008-08-15 Release 5.9 accounting
CG14305 2008-12-18 5.12 accounting

Clone Sequence Records

AT25266.complete Sequence

1299 bp (1299 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089432

> AT25266.complete
CGTTTGTAGGTTTTGTCAAAATTTCTGGATTCGAATTTAGTAAGTAAAAT
ACACAAGTGGCATAAAATTATTGTTTGTGAAATCAACCAACTTAAGGTTG
CAAACTCTCGGAAAACTACACTACACGCACGCCGAGGAAACAAGAGCCAT
GTCCAAATACAATTCTAGCGCTGGGATCCGTCAGTTGGGTACTCGAAGTT
CGGATGTGGATGCACTGGCACAGCGGGGCTACAATGTTGGTCACAAGATC
GGCGAGGGGTCTTATGCCACTGTTATAACCGCCGGTTATGCCGATGATCA
TGGACATGGAGTACATTTGGCCTGTAAAATCATTGACAAAGCCAAGGCGC
CCACTGATTTCGTGAACAAGTTCTTTCCGCGCGAACTGGAGATCCTGACA
AAGATTGATCATTCCAACATTATTCAGATCCATAGCATCCTTCAGCGCGG
TCCCAAGATCTTCATCTTTATGCGTTACGCAGAGAATGGGGATTTGTTGT
CGCACATCAAGAGGTCGGGTCCCATCGATGAGAAGCAATCGAAGATCTGG
TTCTTTCAGATGTCCAAGGCACTGAAGTATCTGCACAACCTGGACATTGC
CCATCGGGATCTCAAGTGCGAGAACATTCTTCTCTCCAAGCGGCTCAACA
TCAAGCTGGCCGATTTCGGATTTGCTCGCTATTGTCGCGACGATAATGGC
CGGGAGATGAAATCTGAGACATACTGCGGATCAGCTGCTTATGCTGCACC
TGAAGTAGTTTGTGGACGACCATATGATCCAAAGCTAGCGGACGCCTGGT
CCTTGGGAGTCATTCTGTTCATCATGATGAATGCCAAGATGCCTTTCGAT
GACAGTAACTTGACCAAATTGCTGGAGGATCAGCGTAACCGCAAGTTTGC
CTTTCGCCGGAAGCTGCAGGAAACGATATCGGCCCAGGCGAAGGCCACTG
TTTCAGTGCTGCTCGAACCGGAGGCACATGCTCGCTGGAATCTACGCGAG
ATCCTTAACTGTGCATGGCTGCGAACCGTCGAGGAATCCCAAACACCCAT
TCCCTAGAACTGACTGCAAGTTTGCAAAATCTCTGAAGCCACTCATCACT
GAGAATCCTATGAGCACTTGCACGCATAGCGCGTTGGTTTCACAGATATG
TGTAAATTGGAATGGTTCCTCAGAAATTCAATGGTATTTTTTCAGAAAGA
TATATCTTTCAACTGTCTGAATCCCATCACCCACTTTTTATTTTGTATGG
TATTAATAAAAAACCAAATGGTGAAGTATTTAAAAAAAAAAAAAAAAAA

AT25266.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14305-RA 1398 CG14305-RA 75..1356 1..1282 6395 99.9 Plus
CG14305.c 1402 CG14305.c 175..1360 97..1282 5915 99.9 Plus
CG14305-RC 1291 CG14305-RC 107..1291 97..1281 5910 99.9 Plus
CG14305-RC 1291 CG14305-RC 1..46 52..97 230 100 Plus
CG14305.c 1402 CG14305.c 75..114 1..40 200 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14423055..14424239 97..1281 5910 99.9 Plus
chr3R 27901430 chr3R 14422898..14422994 1..97 485 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:58:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18598913..18600098 97..1282 5915 99.9 Plus
3R 32079331 3R 18598756..18598852 1..97 485 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18339744..18340929 97..1282 5915 99.9 Plus
3R 31820162 3R 18339587..18339683 1..97 485 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:53:52 has no hits.

AT25266.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:55:00 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14422898..14422994 1..97 100 -> Plus
chr3R 14423056..14424239 98..1281 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:21:08 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
CG14305-RC 1..909 149..1057 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:46:05 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
CG14305-RC 1..909 149..1057 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:49:38 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
CG14305-RA 1..909 149..1057 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:14:29 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
CG14305-RC 1..909 149..1057 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:39 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
CG14305-RA 1..909 149..1057 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:10:27 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
CG14305-RA 1..1281 1..1281 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:46:04 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
CG14305-RA 1..1281 1..1281 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:49:38 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
CG14305-RA 1..1281 1..1281 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:14:29 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
CG14305-RA 1..1281 1..1281 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:39 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
CG14305-RA 1..1281 1..1281 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:55:00 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18598756..18598852 1..97 100 -> Plus
3R 18598914..18600097 98..1281 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:55:00 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18598756..18598852 1..97 100 -> Plus
3R 18598914..18600097 98..1281 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:55:00 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18598756..18598852 1..97 100 -> Plus
3R 18598914..18600097 98..1281 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:49:38 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14424478..14424574 1..97 100 -> Plus
arm_3R 14424636..14425819 98..1281 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:48:11 Download gff for AT25266.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18339745..18340928 98..1281 99   Plus
3R 18339587..18339683 1..97 100 -> Plus

AT25266.hyp Sequence

Translation from 148 to 1056

> AT25266.hyp
MSKYNSSAGIRQLGTRSSDVDALAQRGYNVGHKIGEGSYATVITAGYADD
HGHGVHLACKIIDKAKAPTDFVNKFFPRELEILTKIDHSNIIQIHSILQR
GPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDI
AHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREMKSETYCGSAAYAA
PEVVCGRPYDPKLADAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKF
AFRRKLQETISAQAKATVSVLLEPEAHARWNLREILNCAWLRTVEESQTP
IP*

AT25266.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG14305-PD 302 CG14305-PD 1..302 1..302 1582 100 Plus
CG14305-PC 302 CG14305-PC 1..302 1..302 1582 100 Plus
CG14305-PA 302 CG14305-PA 1..302 1..302 1582 100 Plus
CG9222-PA 337 CG9222-PA 71..332 23..290 482 36.4 Plus
Sik3-PA 702 CG15072-PA 27..292 15..291 395 33.8 Plus

AT25266.pep Sequence

Translation from 148 to 1056

> AT25266.pep
MSKYNSSAGIRQLGTRSSDVDALAQRGYNVGHKIGEGSYATVITAGYADD
HGHGVHLACKIIDKAKAPTDFVNKFFPRELEILTKIDHSNIIQIHSILQR
GPKIFIFMRYAENGDLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDI
AHRDLKCENILLSKRLNIKLADFGFARYCRDDNGREMKSETYCGSAAYAA
PEVVCGRPYDPKLADAWSLGVILFIMMNAKMPFDDSNLTKLLEDQRNRKF
AFRRKLQETISAQAKATVSVLLEPEAHARWNLREILNCAWLRTVEESQTP
IP*

AT25266.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:09:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16910-PA 302 GF16910-PA 1..298 1..298 1504 93 Plus
Dana\GF15399-PA 335 GF15399-PA 70..331 23..290 493 36.8 Plus
Dana\GF11717-PA 1419 GF11717-PA 487..694 28..243 403 38 Plus
Dana\GF18162-PA 741 GF18162-PA 136..387 28..291 400 32.6 Plus
Dana\GF12120-PA 692 GF12120-PA 27..292 15..291 392 32.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:09:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22969-PA 302 GG22969-PA 1..302 1..302 1575 96.4 Plus
Dere\GG10392-PA 337 GG10392-PA 71..332 23..290 494 36.4 Plus
Dere\GG21978-PA 1223 GG21978-PA 496..703 28..243 404 38 Plus
Dere\GG17227-PA 712 GG17227-PA 104..355 28..291 401 32.6 Plus
Dere\GG21916-PA 699 GG21916-PA 27..292 15..291 400 33.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18350-PA 300 GH18350-PA 2..298 5..301 1330 80.5 Plus
Dgri\GH19215-PA 308 GH19215-PA 12..289 14..291 1018 66.9 Plus
Dgri\GH11008-PA 329 GH11008-PA 64..325 23..290 494 37.2 Plus
Dgri\GH24031-PA 711 GH24031-PA 106..313 28..243 399 36.6 Plus
Dgri\GH20210-PA 1146 GH20210-PA 487..694 28..243 397 37.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14305-PD 302 CG14305-PD 1..302 1..302 1582 100 Plus
CG14305-PC 302 CG14305-PC 1..302 1..302 1582 100 Plus
CG14305-PA 302 CG14305-PA 1..302 1..302 1582 100 Plus
CG9222-PA 337 CG9222-PA 71..332 23..290 482 36.4 Plus
Sik3-PA 702 CG15072-PA 27..292 15..291 395 33.8 Plus
Sik3-PF 1379 CG42856-PF 27..292 15..291 395 33.8 Plus
Sik3-PE 1382 CG42856-PE 27..292 15..291 395 33.8 Plus
Sik3-PD 1468 CG42856-PD 27..292 15..291 395 33.8 Plus
Sik3-PC 1471 CG18604-PA 27..292 15..291 395 33.8 Plus
Sik3-PB 1471 CG15072-PB 27..292 15..291 395 33.8 Plus
par-1-PS 827 CG8201-PS 253..504 28..291 393 33.7 Plus
par-1-PW 832 CG8201-PW 253..504 28..291 393 33.7 Plus
par-1-PL 833 CG8201-PL 253..504 28..291 393 33.7 Plus
par-1-PA 938 CG8201-PA 253..504 28..291 393 33.7 Plus
par-1-PV 951 CG8201-PV 253..504 28..291 393 33.7 Plus
par-1-PH 993 CG8201-PH 376..627 28..291 393 33.7 Plus
par-1-PR 1046 CG8201-PR 481..732 28..291 393 33.7 Plus
par-1-PT 1058 CG8201-PT 481..732 28..291 393 33.7 Plus
par-1-PP 1141 CG8201-PP 481..732 28..291 393 33.7 Plus
par-1-PX 1170 CG8201-PX 253..504 28..291 393 33.7 Plus
KP78a-PB 705 CG6715-PB 98..349 28..291 391 32.6 Plus
Sik2-PA 1398 CG4290-PA 141..392 28..291 385 32.6 Plus
KP78b-PB 604 CG17216-PB 42..314 7..291 380 29.8 Plus
KP78b-PA 604 CG17216-PA 42..314 7..291 380 29.8 Plus
CG8485-PC 860 CG8485-PC 20..278 28..296 356 29.2 Plus
CG8485-PB 860 CG8485-PB 20..278 28..296 356 29.2 Plus
CG8485-PA 860 CG8485-PA 20..278 28..296 356 29.2 Plus
CG43143-PD 1180 CG11870-PD 66..342 23..301 349 31.4 Plus
CG43143-PG 1199 CG43143-PG 66..342 23..301 349 31.4 Plus
CG43143-PB 1427 CG11870-PB 66..342 23..301 349 31.4 Plus
CG43143-PC 1427 CG11870-PC 66..342 23..301 349 31.4 Plus
CG43143-PA 1427 CG11870-PA 66..342 23..301 349 31.4 Plus
CG43143-PF 1532 CG43143-PF 66..342 23..301 349 31.4 Plus
CG43143-PH 1551 CG43143-PH 66..342 23..301 349 31.4 Plus
CG43143-PE 2537 CG43143-PE 66..342 23..301 349 31.4 Plus
CG43143-PI 2556 CG43143-PI 66..342 23..301 349 31.4 Plus
lok-PC 459 CG10895-PC 157..425 28..292 347 30.4 Plus
lok-PB 459 CG10895-PB 157..425 28..292 347 30.4 Plus
lok-PA 476 CG10895-PA 174..442 28..292 347 30.4 Plus
sff-PB 845 CG6114-PB 41..269 54..291 344 32.4 Plus
sff-PC 851 CG6114-PC 41..269 54..291 344 32.4 Plus
sff-PA 861 CG6114-PA 41..269 54..291 344 32.4 Plus
AMPKalpha-PC 582 CG3051-PC 28..281 28..292 333 31.6 Plus
AMPKalpha-PB 582 CG3051-PB 28..281 28..292 333 31.6 Plus
AMPKalpha-PA 582 CG3051-PA 28..281 28..292 333 31.6 Plus
CaMKI-PI 390 CG1495-PI 31..297 28..301 309 30.3 Plus
SAK-PA 769 CG7186-PA 14..262 28..286 300 29.8 Plus
aurB-PA 329 CG6620-PA 51..306 26..292 290 28.1 Plus
CaMKI-PA 405 CG1495-PA 31..312 28..301 289 29.1 Plus
CaMKI-PG 405 CG1495-PG 31..312 28..301 289 29.1 Plus
CaMKI-PB 405 CG1495-PB 31..312 28..301 289 29.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23333-PA 300 GI23333-PA 5..295 8..298 1360 83.8 Plus
Dmoj\GI24251-PA 222 GI24251-PA 1..189 108..296 746 71.4 Plus
Dmoj\GI17526-PA 329 GI17526-PA 64..328 23..293 495 36.8 Plus
Dmoj\GI20735-PA 1228 GI20735-PA 500..707 28..243 402 38 Plus
Dmoj\GI10063-PA 766 GI10063-PA 131..382 28..291 396 32.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24355-PA 302 GL24355-PA 1..302 1..302 1445 87.4 Plus
Dper\GL10531-PA 1212 GL10531-PA 484..691 28..243 402 38 Plus
Dper\GL12610-PA 733 GL12610-PA 124..331 28..243 398 36.6 Plus
Dper\GL10764-PA 617 GL10764-PA 33..298 15..291 392 33.1 Plus
Dper\GL15126-PA 1366 GL15126-PA 144..395 28..291 385 32.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12894-PA 302 GA12894-PA 1..302 1..302 1444 87.4 Plus
Dpse\GA21624-PB 334 GA21624-PB 69..327 23..285 484 36.4 Plus
Dpse\GA24400-PA 1212 GA24400-PA 484..691 28..243 402 38 Plus
Dpse\GA19806-PA 735 GA19806-PA 124..331 28..243 397 36.6 Plus
Dpse\GA24476-PA 712 GA24476-PA 36..301 15..291 390 33.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17875-PA 302 GM17875-PA 1..302 1..302 1596 97.7 Plus
Dsec\GM18607-PA 337 GM18607-PA 71..332 23..290 494 36.4 Plus
Dsec\GM21966-PA 1192 GM21966-PA 470..677 28..243 402 38 Plus
Dsec\GM26104-PA 705 GM26104-PA 98..305 28..243 399 35.6 Plus
Dsec\GM21908-PA 703 GM21908-PA 27..292 15..291 389 32.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19235-PA 302 GD19235-PA 1..302 1..302 1599 98 Plus
Dsim\GD23390-PA 337 GD23390-PA 71..332 23..290 494 36.4 Plus
Dsim\GD20665-PA 603 GD20665-PA 63..314 28..291 384 29.9 Plus
Dsim\GD18682-PA 1567 GD18682-PA 63..274 25..243 359 36.2 Plus
Dsim\GD20664-PA 558 GD20664-PA 1..202 82..291 351 33.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10334-PA 300 GJ10334-PA 5..295 8..298 1377 85.9 Plus
Dvir\GJ10823-PA 318 GJ10823-PA 1..294 1..296 1159 72.3 Plus
Dvir\GJ15400-PA 329 GJ15400-PA 64..326 23..291 493 36.7 Plus
Dvir\GJ20472-PA 1208 GJ20472-PA 480..687 28..243 402 38 Plus
Dvir\GJ23798-PA 756 GJ23798-PA 130..337 28..243 401 37 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13092-PA 316 GK13092-PA 1..300 1..298 1364 84 Plus
Dwil\GK15382-PA 327 GK15382-PA 62..323 23..290 487 36.4 Plus
Dwil\GK15874-PA 1239 GK15874-PA 512..719 28..243 402 38 Plus
Dwil\GK11799-PA 719 GK11799-PA 115..366 28..291 392 32.6 Plus
Dwil\GK20917-PA 755 GK20917-PA 35..300 15..291 387 32.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25543-PA 302 GE25543-PA 1..302 1..302 1574 96.4 Plus
Dyak\GE25544-PA 246 GE25544-PA 1..246 62..302 1197 91.5 Plus
Dyak\GE13670-PA 336 GE13670-PA 70..331 23..290 494 36.4 Plus
Dyak\GE24627-PA 709 GE24627-PA 102..353 28..291 402 32.6 Plus
Dyak\GE11992-PA 704 GE11992-PA 27..292 15..291 398 33.5 Plus