Clone AT25465 Report

Search the DGRC for AT25465

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:254
Well:65
Vector:pOTB7
Associated Gene/TranscriptCG6380-RA
Protein status:AT25465.pep: gold
Preliminary Size:1038
Sequenced Size:1088

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6380 2003-01-01 Sim4 clustering to Release 3
CG6380 2004-01-09 Blastp of sequenced clone
CG6380 2008-04-29 Release 5.5 accounting
CG6380 2008-08-15 Release 5.9 accounting
CG6380 2008-12-18 5.12 accounting

Clone Sequence Records

AT25465.complete Sequence

1088 bp (1088 high quality bases) assembled on 2004-01-09

GenBank Submission: BT011398

> AT25465.complete
GCCATATAGGGCACACACAAGTTTACACTAATACATTTTAGTTCGGTAAT
TAGTTCCTTTCAAAGGCCAAAACTACACATAGCTACAAACAAGAATGGAT
GGGGACCAAGTAAAGGGCATCCTGAAGTCGGGAAACAATAGTGCGCAATT
TAGCCTGAAGGCAGCCAAATTTGATGAGGTCAACATACTGGCCACGTTCC
ACCCGGCTGGTAAGGACTACGGCCACATGATCATCGACGAACCAAAGACA
CCCTTCGTCTTTGAGGAGGATTTGCCAAAGGAGTTGGATACAAATGCCCT
GATCGAAAAGTTGAGACACACATCAAAGTCAGAAATGCCGGCATTTGGCA
TCGAAGGAGACTCAGAAGAATCCTCGGCGGATGAGGACTTTCCCGAGTCT
GTAGAGGAAAAAGTGCGTAGAATGGAGTTTGAGAGGCGGCGAAAAGTGCA
TTACAAGGAGTTCTATTCGGTTCCACTGGCTCGACGTCTTATAGCCGACG
AGTTTGCCGAGTTGACCAGTTCAGAGTTTAATATTCACTGCGAAGGGGGA
ATGGAATCTTGTGAAGCGTGCAGTGAAAACAATCAACTCGACGGCGAAGC
AAGCAACTTGACGCAAACAAAATACTCATATTCTGAAAGTCAATCCGAAT
ACAGGATATCAGATCATTCTGAGCCTGAACCAGGTTTCTCCCCCAGCCAT
CACTGCTACCAAAAACTGAAGGCCGAGCTCTTTAGCAAAGCAGAGCCGGA
AGAATTGGCCTCTTTAACGCACTTGCATCGAATGCCATCGGTCAACGATG
ATGAACCAAGTCGCGAGCCTCGCGTCCCATACCCTTCGGTTGTTCCGACT
CAAACCCAAAATCTACATGAACACAAGAGTTCACTGAAAATAACGTCCGA
GAAGCCTACTCCTGCTCGTATATGTAAATCCAACCCTGATAATCGTCCTG
GCACTTCTAAGAAAGAGACCCGCTGAAATCATTCAGTAGTGTTAAAAATT
GCAAAGTTATATTAAAGAAACTTGTAATTATAACAAACCATTGGGGATTA
AAACTTGTGTATGCATTTGAAAAAAAAAAAAAAAAAAA

AT25465.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG6380-RA 1074 CG6380-RA 6..1074 1..1069 5345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17289828..17290896 1069..1 5345 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:58:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17291133..17292202 1070..1 5350 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17291133..17292202 1070..1 5350 100 Minus
Blast to na_te.dros performed 2019-03-15 19:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
Juan 4236 Juan JUAN 4236bp 3070..3140 976..1045 109 63.4 Plus

AT25465.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:07:09 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17289828..17290896 1..1069 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:21:20 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6380-RA 1..882 95..976 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:43:36 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6380-RA 1..882 95..976 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:41:03 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6380-RA 1..882 95..976 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:32:25 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6380-RA 1..882 95..976 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:09:16 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6380-RA 1..882 95..976 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:53:53 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6380-RA 6..1038 1..1033 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:43:36 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6380-RA 1..1069 1..1069 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:41:03 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6380-RA 1..1069 1..1069 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:32:25 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6380-RA 6..1038 1..1033 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:09:16 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
CG6380-RA 1..1069 1..1069 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:09 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17291134..17292202 1..1069 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:09 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17291134..17292202 1..1069 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:09 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17291134..17292202 1..1069 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:41:03 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17291134..17292202 1..1069 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:05:03 Download gff for AT25465.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17291134..17292202 1..1069 100   Minus

AT25465.hyp Sequence

Translation from 94 to 975

> AT25465.hyp
MDGDQVKGILKSGNNSAQFSLKAAKFDEVNILATFHPAGKDYGHMIIDEP
KTPFVFEEDLPKELDTNALIEKLRHTSKSEMPAFGIEGDSEESSADEDFP
ESVEEKVRRMEFERRRKVHYKEFYSVPLARRLIADEFAELTSSEFNIHCE
GGMESCEACSENNQLDGEASNLTQTKYSYSESQSEYRISDHSEPEPGFSP
SHHCYQKLKAELFSKAEPEELASLTHLHRMPSVNDDEPSREPRVPYPSVV
PTQTQNLHEHKSSLKITSEKPTPARICKSNPDNRPGTSKKETR*

AT25465.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG6380-PB 293 CG6380-PB 1..293 1..293 1541 100 Plus
CG6380-PA 293 CG6380-PA 1..293 1..293 1541 100 Plus
I-2-PA 205 CG10574-PA 12..144 7..136 315 51.5 Plus
I-2-PB 310 CG10574-PB 117..249 7..136 315 51.5 Plus
CG12620-PB 287 CG12620-PB 4..237 22..251 259 30.9 Plus

AT25465.pep Sequence

Translation from 94 to 975

> AT25465.pep
MDGDQVKGILKSGNNSAQFSLKAAKFDEVNILATFHPAGKDYGHMIIDEP
KTPFVFEEDLPKELDTNALIEKLRHTSKSEMPAFGIEGDSEESSADEDFP
ESVEEKVRRMEFERRRKVHYKEFYSVPLARRLIADEFAELTSSEFNIHCE
GGMESCEACSENNQLDGEASNLTQTKYSYSESQSEYRISDHSEPEPGFSP
SHHCYQKLKAELFSKAEPEELASLTHLHRMPSVNDDEPSREPRVPYPSVV
PTQTQNLHEHKSSLKITSEKPTPARICKSNPDNRPGTSKKETR*

AT25465.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15110-PA 288 GF15110-PA 3..281 1..285 672 53.7 Plus
Dana\GF25124-PA 210 GF25124-PA 12..141 7..133 259 53.4 Plus
Dana\GF14784-PA 291 GF14784-PA 71..212 99..238 201 38 Plus
Dana\GF14783-PA 308 GF14783-PA 76..189 98..208 172 40.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21754-PA 293 GG21754-PA 1..293 1..293 1280 80.5 Plus
Dere\GG14003-PA 205 GG14003-PA 12..144 7..136 248 52.9 Plus
Dere\GG21073-PA 293 GG21073-PA 39..192 62..212 226 36.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10084-PA 240 GH10084-PA 7..215 6..211 426 53.1 Plus
Dgri\GH16012-PA 207 GH16012-PA 12..143 7..136 265 53.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG6380-PB 293 CG6380-PB 1..293 1..293 1541 100 Plus
CG6380-PA 293 CG6380-PA 1..293 1..293 1541 100 Plus
I-2-PA 205 CG10574-PA 12..144 7..136 315 51.5 Plus
I-2-PB 310 CG10574-PB 117..249 7..136 315 51.5 Plus
CG12620-PB 287 CG12620-PB 4..237 22..251 259 30.9 Plus
CG12620-PA 287 CG12620-PA 4..237 22..251 259 30.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14265-PA 249 GI14265-PA 1..221 1..211 564 58.3 Plus
Dmoj\GI12278-PA 202 GI12278-PA 12..144 7..136 253 51.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19746-PA 262 GL19746-PA 1..246 1..241 563 52.6 Plus
Dper\GL22570-PA 281 GL22570-PA 1..265 1..250 554 51.3 Plus
Dper\GL22569-PA 281 GL22569-PA 1..265 1..250 554 51.3 Plus
Dper\GL16322-PA 199 GL16322-PA 12..136 7..133 262 54.6 Plus
Dper\GL14331-PA 233 GL14331-PA 1..214 1..210 197 31.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19552-PA 262 GA19552-PA 1..246 1..241 563 52.6 Plus
Dpse\GA24711-PA 281 GA24711-PA 1..265 1..250 552 50.9 Plus
Dpse\GA24707-PA 281 GA24707-PA 1..265 1..250 552 50.9 Plus
Dpse\GA10405-PA 199 GA10405-PA 12..136 7..133 262 54.6 Plus
Dpse\GA25070-PA 233 GA25070-PA 1..214 1..210 195 31.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17136-PA 292 GM17136-PA 1..292 1..293 1465 95.2 Plus
Dsec\GM24837-PA 310 GM24837-PA 116..246 6..133 245 53 Plus
Dsec\GM17223-PA 271 GM17223-PA 36..181 69..211 214 37.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21878-PA 293 GD21878-PA 1..293 1..293 1479 94.9 Plus
Dsim\GD24098-PA 273 GD24098-PA 36..181 69..211 220 38.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16238-PA 260 GJ16238-PA 1..218 1..212 571 59 Plus
Dvir\GJ13214-PA 205 GJ13214-PA 12..141 7..133 247 51.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23801-PA 277 GK23801-PA 3..254 2..250 602 54.9 Plus
Dwil\GK11748-PA 198 GK11748-PA 12..143 7..136 245 54.7 Plus
Dwil\GK23876-PA 186 GK23876-PA 8..176 48..211 219 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13145-PA 294 GE13145-PA 1..294 1..293 1297 83.7 Plus
Dyak\GE20298-PA 318 GE20298-PA 125..254 7..133 247 52.6 Plus
Dyak\GE12782-PA 290 GE12782-PA 46..205 69..219 213 38.1 Plus