Clone AT25567 Report

Search the DGRC for AT25567

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:255
Well:67
Vector:pOTB7
Associated Gene/TranscriptCG6607-RA
Protein status:AT25567.pep: gold
Preliminary Size:1485
Sequenced Size:1484

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6607 2002-01-01 Sim4 clustering to Release 2
CG6607 2002-02-22 Blastp of sequenced clone
CG6607 2003-01-01 Sim4 clustering to Release 3
CG6607 2008-04-29 Release 5.5 accounting
CG6607 2008-08-15 Release 5.9 accounting
CG6607 2008-12-18 5.12 accounting

Clone Sequence Records

AT25567.complete Sequence

1484 bp (1484 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089438

> AT25567.complete
ATTTGTTTAAAACAATTTAGAAACCGTGCAAAGAACTCCACCGCCGGCAA
CCACATAGACCTTAAAGCCAGCCTGGATGGCAGAGAAATCGCTAGCCATG
GATGGCACGGTGCCGGAGGCCAAGTACCAGAAATTGGCCACAGAATACTC
AAAGCTGCGGGCACAAGCGACGGTGCTAAAGAAGGCGGTGCTGGAGGAGC
AGTCCAAGGAGGCCAGTCTGCGGGAGCAACTGCAGCAGTACGCCACCTCG
TTGCGCCGTACGGAGCAGGAGGTGGACTCGCTGGGCTTTCGCAACAAGCA
GCTGGAGTCGCGAGTTTCGCAGCTGCAGCAGGAAATCTCGGTGCACGAGC
AGCCCAAAAAGAAGGACAAGGATTCTGGCGGCAGGCGGGGCGTGCAGAGC
AATAGCCGCCCAGATGCCGATCCATCATTGGATGCCGCTCAGGAAGCCCT
CATCTTCGAGGAACTGCAGAAGAAAATCATGGAGAATGCGCAGCTGACGT
CATTGATTGACGACAAGCAAAGGGATCTGCTGCTGCACACGGAGCGCATA
GCATCGTTGGAACAGAAGCTGGAGAAACGCATCGGCGATCAGAACGAACT
GGAGAAGCGACTCAGGAAGGAGGTGGAAACGCTGCAGCACAGGAACAGCG
AGCTGGAAACAAAGCTGGTTGATGCGGCCAGCATGCTTGGCAGCGAGGAC
GCACTGAGCGCCACCGGCAGCGATACTACTCCTCTACACAATCTCCAGCA
GCAGTCGAATAGCAACCAACTCACCTCCGAGGATCGCATTGCGCTGCTCG
AGAAGGAGGCGGCGCATTGGAGGGCTCAATTCGAAGTGGCCAAGCTGCAT
CAAGCATTTGTCTCGAACCCCAGCAAGGATCTCAGCACGTGCAGCTGCAG
CACGGCGGCGGCGGGCGTCACCGTTCGACCGGCAGAGTCGGAGGCGAAAG
GCAGCCAGCGGGCGCGGGATTCGCTGCAGGATCCCCCCGAACCGCCCACC
AAGGAGCAGCTCATCTACAGTGTGTTCAGCAAGAAGTTCGAGGATCTGAT
GCGACTGAAAGTGCAAGCGGAATCCAAGTTGCGATCCTACGAGCTGGAGG
TTCAGCACCTGCAAAACTGCCTGGAGAACGCAACGCACGAACTTAAGGCC
AAGGACGATCAGTTGGCCAGTTTGGGTGGAGCCCTGCAAATGCTCGAAGA
GGAGTTGACTACGACGCGTATTAACTACGAGGAGCAAATCAGCGTGCTGA
CGGAGCAGGTCATCAGCTTGAGTGACCAGCTGGCCGCCTGCAAATGAGCA
TGGACAGCGGCGCGCATCCCGCCCAGCTGCTTTACTGTATATTGTTGTAA
AATAACTAACTGGGAACGCCCGCTCCCCCTCTACCCTGTTTTGTTATTGT
CCACCCTCGACGTGTATATAACTGAACATTCTATGTGTATTAAATAATTC
TCTAAAGTTTAAAAAAAAAAAAAAAAAAAAAAAA

AT25567.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG6607-RA 1617 CG6607-RA 151..1613 1..1463 7315 100 Plus
CG13623-RA 796 CG13623-RA 680..796 1463..1347 585 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20352249..20352771 685..1207 2585 99.6 Plus
chr3R 27901430 chr3R 20351600..20351952 153..505 1660 98 Plus
chr3R 27901430 chr3R 20352830..20353083 1207..1460 1255 99.6 Plus
chr3R 27901430 chr3R 20352016..20352196 505..685 875 98.9 Plus
chr3R 27901430 chr3R 20351369..20351522 1..154 755 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:58:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24528981..24529503 685..1207 2615 100 Plus
3R 32079331 3R 24528332..24528684 153..505 1765 100 Plus
3R 32079331 3R 24529562..24529818 1207..1463 1285 100 Plus
3R 32079331 3R 24528748..24528928 505..685 905 100 Plus
3R 32079331 3R 24528101..24528254 1..154 770 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24269812..24270334 685..1207 2615 100 Plus
3R 31820162 3R 24269163..24269515 153..505 1765 100 Plus
3R 31820162 3R 24270393..24270649 1207..1463 1285 100 Plus
3R 31820162 3R 24269579..24269759 505..685 905 100 Plus
3R 31820162 3R 24268932..24269085 1..154 770 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:14:33 has no hits.

AT25567.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:15:35 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20352017..20352196 506..685 98 -> Plus
chr3R 20351369..20351522 1..154 99 -> Plus
chr3R 20351602..20351952 155..505 98 -> Plus
chr3R 20352250..20352771 686..1207 99 -> Plus
chr3R 20352831..20353083 1208..1460 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:21:35 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
CG6607-RA 1..1221 77..1297 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:41:12 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
CG6607-RA 1..1221 77..1297 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:08:32 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
CG6607-RA 1..1221 77..1297 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:10:30 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
CG6607-RA 1..1221 77..1297 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:32:31 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
CG6607-RA 1..1221 77..1297 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:06:04 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
CG6607-RA 26..1485 1..1460 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:41:12 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
CG6607-RA 26..1485 1..1460 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:08:32 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
CG6607-RA 55..1514 1..1460 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:10:30 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
CG6607-RA 26..1485 1..1460 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:32:31 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
CG6607-RA 55..1514 1..1460 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:35 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24528101..24528254 1..154 100 -> Plus
3R 24528334..24528684 155..505 100 -> Plus
3R 24528749..24528928 506..685 100 -> Plus
3R 24528982..24529503 686..1207 100 -> Plus
3R 24529563..24529815 1208..1460 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:35 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24528101..24528254 1..154 100 -> Plus
3R 24528334..24528684 155..505 100 -> Plus
3R 24528749..24528928 506..685 100 -> Plus
3R 24528982..24529503 686..1207 100 -> Plus
3R 24529563..24529815 1208..1460 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:35 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24528101..24528254 1..154 100 -> Plus
3R 24528334..24528684 155..505 100 -> Plus
3R 24528749..24528928 506..685 100 -> Plus
3R 24528982..24529503 686..1207 100 -> Plus
3R 24529563..24529815 1208..1460 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:08:32 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20353823..20353976 1..154 100 -> Plus
arm_3R 20355285..20355537 1208..1460 100   Plus
arm_3R 20354056..20354406 155..505 100 -> Plus
arm_3R 20354471..20354650 506..685 100 -> Plus
arm_3R 20354704..20355225 686..1207 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:44:50 Download gff for AT25567.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24269165..24269515 155..505 100 -> Plus
3R 24269580..24269759 506..685 100 -> Plus
3R 24269813..24270334 686..1207 100 -> Plus
3R 24270394..24270646 1208..1460 100   Plus
3R 24268932..24269085 1..154 100 -> Plus

AT25567.pep Sequence

Translation from 76 to 1296

> AT25567.pep
MAEKSLAMDGTVPEAKYQKLATEYSKLRAQATVLKKAVLEEQSKEASLRE
QLQQYATSLRRTEQEVDSLGFRNKQLESRVSQLQQEISVHEQPKKKDKDS
GGRRGVQSNSRPDADPSLDAAQEALIFEELQKKIMENAQLTSLIDDKQRD
LLLHTERIASLEQKLEKRIGDQNELEKRLRKEVETLQHRNSELETKLVDA
ASMLGSEDALSATGSDTTPLHNLQQQSNSNQLTSEDRIALLEKEAAHWRA
QFEVAKLHQAFVSNPSKDLSTCSCSTAAAGVTVRPAESEAKGSQRARDSL
QDPPEPPTKEQLIYSVFSKKFEDLMRLKVQAESKLRSYELEVQHLQNCLE
NATHELKAKDDQLASLGGALQMLEEELTTTRINYEEQISVLTEQVISLSD
QLAACK*

AT25567.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20757-PA 419 GF20757-PA 1..419 1..406 1717 81.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11301-PA 399 GG11301-PA 1..399 8..406 2021 97 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18829-PA 422 GH18829-PA 1..422 1..406 1630 77.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG6607-PA 406 CG6607-PA 1..406 1..406 2004 100 Plus
CLIP-190-PN 1598 CG5020-PN 853..1248 15..404 161 20.7 Plus
CLIP-190-PR 1601 CG5020-PR 856..1251 15..404 161 20.7 Plus
CLIP-190-PP 1623 CG5020-PP 878..1273 15..404 161 20.7 Plus
CLIP-190-PC 1652 CG5020-PC 907..1302 15..404 161 20.7 Plus
CLIP-190-PS 1653 CG5020-PS 908..1303 15..404 161 20.7 Plus
CLIP-190-PM 1668 CG5020-PM 923..1318 15..404 161 20.7 Plus
CLIP-190-PB 1689 CG5020-PB 944..1339 15..404 161 20.7 Plus
CLIP-190-PA 1690 CG5020-PA 945..1340 15..404 161 20.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10086-PA 425 GI10086-PA 1..425 1..406 1557 75.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21870-PA 417 GL21870-PA 1..417 1..406 1782 83 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19719-PA 417 GA19719-PA 1..417 1..406 1791 83.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26608-PA 403 GM26608-PA 1..403 1..406 1996 95.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15182-PA 406 GD15182-PA 1..406 1..406 2083 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23821-PA 421 GJ23821-PA 1..421 1..406 1546 76.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22345-PA 401 GK22345-PA 5..401 9..406 1450 73.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23495-PA 407 GE23495-PA 1..407 1..406 2027 96.1 Plus

AT25567.hyp Sequence

Translation from 76 to 1296

> AT25567.hyp
MAEKSLAMDGTVPEAKYQKLATEYSKLRAQATVLKKAVLEEQSKEASLRE
QLQQYATSLRRTEQEVDSLGFRNKQLESRVSQLQQEISVHEQPKKKDKDS
GGRRGVQSNSRPDADPSLDAAQEALIFEELQKKIMENAQLTSLIDDKQRD
LLLHTERIASLEQKLEKRIGDQNELEKRLRKEVETLQHRNSELETKLVDA
ASMLGSEDALSATGSDTTPLHNLQQQSNSNQLTSEDRIALLEKEAAHWRA
QFEVAKLHQAFVSNPSKDLSTCSCSTAAAGVTVRPAESEAKGSQRARDSL
QDPPEPPTKEQLIYSVFSKKFEDLMRLKVQAESKLRSYELEVQHLQNCLE
NATHELKAKDDQLASLGGALQMLEEELTTTRINYEEQISVLTEQVISLSD
QLAACK*

AT25567.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG6607-PA 406 CG6607-PA 1..406 1..406 2004 100 Plus
CLIP-190-PN 1598 CG5020-PN 853..1248 15..404 161 20.7 Plus
CLIP-190-PR 1601 CG5020-PR 856..1251 15..404 161 20.7 Plus
CLIP-190-PP 1623 CG5020-PP 878..1273 15..404 161 20.7 Plus
CLIP-190-PC 1652 CG5020-PC 907..1302 15..404 161 20.7 Plus