Clone AT25643 Report

Search the DGRC for AT25643

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:256
Well:43
Vector:pOTB7
Associated Gene/TranscriptCG32235-RA
Protein status:AT25643.pep: gold
Sequenced Size:615

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13703 2002-01-01 Sim4 clustering to Release 2
CG32235 2002-06-11 Blastp of sequenced clone
CG32235 2003-01-01 Sim4 clustering to Release 3
CG32235 2008-04-29 Release 5.5 accounting
CG32235 2008-08-15 Release 5.9 accounting
CG32235 2008-12-18 5.12 accounting

Clone Sequence Records

AT25643.complete Sequence

615 bp (615 high quality bases) assembled on 2002-06-11

GenBank Submission: AY070820

> AT25643.complete
GTTCGGAGCTCCCTAATAGGGTTGCAGCTGAAGGGGAGAATCGCATACAT
AATGCTACGAGGCAGCATAATCATGAGCCGATTTCACAAGGAGATCCTAT
TGCATTTCGGCTGCCAAAGGAATTTACTTTAACAAAGACGCTTCAAGTGG
CATTGGTGTTTTGAGCGACTGAATTGCGAATAGAGCAGCAATTAATTGTG
GACAACGCATTTTGGCTTTGAGAGCGCAGTAAATGCGGTTGCCACACATG
CGAAAGTTAAAGGAAATCGTGTGTGTTTTAAGGTGACAAGTCGTGGGAAT
AGCCAGGCATGCGAAACCATCAACGCAGGCCGGGAAAAGCAGGATTCAGG
TTCCCGTATGCAGGTCATCCGCCTGTCACGTGCCTAAGCGCACCGGACAA
CGCAATGCAGGTGCCACCGACAGGTCCTTCGGGGATCGAGGTACCTGGGT
GTGGGCTTTCCAGCTGCAGTGCATCCAGAGCCATGCGTGACAAATATTTA
TTAACTGCCACAACTGCCGGGCATCGGCTTAGAGGATTGATCTTGGCATT
AGAGAGCTAATAAAAAATTGATTCCGACTTCGTCAATTGTCACAAATAAA
AAAAAAAAAAAAAAA

AT25643.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG32235.a 863 CG32235.a 266..863 1..598 2990 100 Plus
CG32235-RA 598 CG32235-RA 1..598 1..598 2990 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4859248..4859645 597..200 1990 100 Minus
chr3L 24539361 chr3L 4859708..4859905 201..1 910 98 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:58:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4859808..4860207 599..200 2000 100 Minus
3L 28110227 3L 4860270..4860470 201..1 1005 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:47:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4859808..4860207 599..200 2000 100 Minus
3L 28103327 3L 4860270..4860470 201..1 1005 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:15:34 has no hits.

AT25643.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:16:14 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4859248..4859644 201..597 100 <- Minus
chr3L 4859709..4859905 1..200 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:21:41 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
CG32235-RA 1..252 309..560 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:33:10 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
CG32235-RA 1..252 309..560 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:25 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
CG32235-RA 1..252 309..560 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:17:05 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
CG32235-RA 1..252 309..560 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:47:42 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
CG32235-RA 1..252 309..560 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:38:52 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
CG32235-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:33:09 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
CG32235-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:25 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
CG32235-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:17:05 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
CG32235-RA 1..597 1..597 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:47:42 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
CG32235-RA 1..597 1..597 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:14 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4859810..4860206 201..597 100 <- Minus
3L 4860271..4860470 1..200 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:14 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4859810..4860206 201..597 100 <- Minus
3L 4860271..4860470 1..200 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:16:14 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4859810..4860206 201..597 100 <- Minus
3L 4860271..4860470 1..200 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:25 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4859810..4860206 201..597 100 <- Minus
arm_3L 4860271..4860470 1..200 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:54:03 Download gff for AT25643.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4859810..4860206 201..597 100 <- Minus
3L 4860271..4860470 1..200 100   Minus

AT25643.hyp Sequence

Translation from 308 to 559

> AT25643.hyp
MRNHQRRPGKAGFRFPYAGHPPVTCLSAPDNAMQVPPTGPSGIEVPGCGL
SSCSASRAMRDKYLLTATTAGHRLRGLILALES*

AT25643.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG32235-PA 83 CG32235-PA 1..83 1..83 444 100 Plus

AT25643.pep Sequence

Translation from 308 to 559

> AT25643.pep
MRNHQRRPGKAGFRFPYAGHPPVTCLSAPDNAMQVPPTGPSGIEVPGCGL
SSCSASRAMRDKYLLTATTAGHRLRGLILALES*

AT25643.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14155-PA 85 GG14155-PA 1..84 1..82 157 51.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG32235-PA 83 CG32235-PA 1..83 1..83 444 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13941-PA 83 GM13941-PA 1..83 1..83 373 90.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13225-PA 83 GD13225-PA 1..83 1..83 389 92.8 Plus