Clone AT25705 Report

Search the DGRC for AT25705

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:257
Well:5
Vector:pOTB7
Associated Gene/TranscriptOscp-RB
Protein status:AT25705.pep: wuzgold
Preliminary Size:862
Sequenced Size:903

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4307 2003-02-13 Blastp of sequenced clone
Oscp 2008-04-29 Release 5.5 accounting
Oscp 2008-08-15 Release 5.9 accounting
Oscp 2008-12-18 5.12 accounting

Clone Sequence Records

AT25705.complete Sequence

903 bp (903 high quality bases) assembled on 2003-02-13

GenBank Submission: BT003799

> AT25705.complete
ATTTTTATTGCGTTTGCAACCCGCTGTCGCATATGTAGAATTATCTAACG
CGCGTTTCTTGGTTATGTAATTTTTGCCCATCTTAACCCACGAACCGCGG
GTAGTTTATGTTTAATAAGCCGAAAAACTTACCAAGTGCTCTTGTTTGCT
TATCCCGCAGAGCCGCACCCTCAGCTCCGCTGCCGCCCAGGCGACGGTGA
AGCCACCAGTGCAGGTGTTCGGTCTGGAGGGTCGCTATGCTACCGCCCTG
TATTCGGCTGCCTCCAAGTTGAGCCAGTTGGATCAGGTGGAGAAGGATCT
GACGGCCCTGCAGGCCACCATCCGTAGCGACAAGAAGCTGCGCGAGTACG
TGACCAGCCCCATCATCAACAAGAAGGTCATGGCCACCGCTCTGAAGGAG
GCATCCGAGAAGCTCCGCTTCGCCCCGGCCACCGTCAATCTGTTGGGTCT
GCTGGCTGACAACGGACGTCTAAAGAAGCTGGACACCGTGATCAATGCCT
ACAAGACCATCATGGCCGCACATCGCGGTGAGGTCGTCTGCGAGGTGGTC
ACCGCCAAGCCCTTGGATGCGTCCCAGAGCAAGCAGCTGGAGGGTGCCCT
TAAGTCTTTCCTGAAGGGCAACGAGTCTCTGAAGATCACTTCCCGCGTGG
ACCCCAGCATCATTGGTGGCCTGATCGTTTCCATTGGCGACAAGTACGTC
GACATGAGCATTGCCACTAAGGTCAAGCTCTACACCGATGTCATCCAGAC
CGCTGCCTAGACTCTTAAGGATTTGCTCTTGATTTAGATGGTCAAACTGA
AAGTTTGGTATTGGAATTCAAGCGGTAATAGCGAATAAAACACTCTTCAC
CCTTTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

AT25705.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-RB 1121 Oscp-RB 196..1055 1..860 4300 100 Plus
Oscp-RA 1098 Oscp-RA 332..1032 160..860 3505 100 Plus
Oscp.a 1019 Oscp.a 272..972 160..860 3505 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11090397..11091000 1..604 3020 100 Plus
chr3R 27901430 chr3R 11091061..11091314 603..856 1270 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:58:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15265767..15266370 1..604 3020 100 Plus
3R 32079331 3R 15266431..15266688 603..860 1290 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15006598..15007201 1..604 3020 100 Plus
3R 31820162 3R 15007262..15007519 603..860 1290 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:56:54 has no hits.

AT25705.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:57:41 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11090397..11091000 1..604 100 -> Plus
chr3R 11091063..11091314 605..856 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:21:45 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 30..630 160..760 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:45:11 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 30..630 160..760 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:50:08 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 30..630 160..760 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:36:37 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 30..630 160..760 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:48:40 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 30..630 160..760 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:56:07 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RB 1..856 1..856 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:45:11 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RB 1..856 1..856 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:50:08 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RB 1..856 1..856 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:36:37 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RB 1..856 1..856 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:48:40 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 100..796 160..856 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:57:41 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15265767..15266370 1..604 100 -> Plus
3R 15266433..15266684 605..856 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:57:41 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15265767..15266370 1..604 100 -> Plus
3R 15266433..15266684 605..856 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:57:41 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15265767..15266370 1..604 100 -> Plus
3R 15266433..15266684 605..856 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:50:08 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11092155..11092406 605..856 100   Plus
arm_3R 11091489..11092092 1..604 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:06:39 Download gff for AT25705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15006598..15007201 1..604 100 -> Plus
3R 15007264..15007515 605..856 100   Plus

AT25705.pep Sequence

Translation from 379 to 759

> AT25705.pep
MATALKEASEKLRFAPATVNLLGLLADNGRLKKLDTVINAYKTIMAAHRG
EVVCEVVTAKPLDASQSKQLEGALKSFLKGNESLKITSRVDPSIIGGLIV
SIGDKYVDMSIATKVKLYTDVIQTAA*

AT25705.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11421-PA 209 GF11421-PA 84..209 1..126 606 92.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16904-PA 209 GG16904-PA 84..209 1..126 645 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18853-PA 208 GH18853-PA 83..208 1..126 628 95.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsynO-PA 209 CG4307-PA 84..209 1..126 611 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22923-PA 209 GI22923-PA 84..209 1..126 594 89.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12538-PA 210 GL12538-PA 85..210 1..126 577 87.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18097-PA 210 GA18097-PA 85..210 1..126 573 86.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24212-PA 209 GM24212-PA 84..209 1..126 646 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19002-PA 126 GD19002-PA 1..126 1..126 641 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23207-PA 209 GJ23207-PA 84..209 1..126 592 90.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13792-PA 208 GK13792-PA 83..208 1..126 624 96 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:48:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24286-PA 209 GE24286-PA 84..209 1..126 646 99.2 Plus

AT25705.hyp Sequence

Translation from 379 to 759

> AT25705.hyp
MATALKEASEKLRFAPATVNLLGLLADNGRLKKLDTVINAYKTIMAAHRG
EVVCEVVTAKPLDASQSKQLEGALKSFLKGNESLKITSRVDPSIIGGLIV
SIGDKYVDMSIATKVKLYTDVIQTAA*

AT25705.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-PA 209 CG4307-PA 84..209 1..126 611 100 Plus