BDGP Sequence Production Resources |
Search the DGRC for AT26083
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 260 |
Well: | 83 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG31226-RA |
Protein status: | AT26083.pep: gold |
Sequenced Size: | 427 |
Gene | Date | Evidence |
---|---|---|
CG31226 | 2001-12-16 | Blastp of sequenced clone |
CG18208 | 2002-01-01 | Sim4 clustering to Release 2 |
CG31226 | 2003-01-01 | Sim4 clustering to Release 3 |
CG31226 | 2008-04-29 | Release 5.5 accounting |
CG31226 | 2008-08-15 | Release 5.9 accounting |
CG31226 | 2008-12-18 | 5.12 accounting |
427 bp (427 high quality bases) assembled on 2001-12-16
GenBank Submission: AY070822
> AT26083.complete AATTCGTACTCTTCGGACGGTAACGGAACAAAAAATTCCTAAATAAATTT CCTAGTTTTTTTTCCGGCAAAACAAGTAACGACAAATCAATTCACCATGT GCAGCTATCCTTGCTATCCTTGCGCCGCCTTGTGTCCCTGCGGAGGCAGT GGACCAAGTGGATTCTACGATCCGTGCTTTGGACCCTACAACGGACCATT TAACTCCTGGTGCGGAGCAAGTGGACCCGGTTTCTGGAGAGGTGGATGTT GCTAGTTTTTGTCATGAGCTGTAGGATTGAGCTACTTTCTCACACGGAAA AATTGGAATTGCTGAACATCTCTTGCAAGGAAACTAAATTACCGTCCCAC ATGAAGAGAGAAATGTTAATTAAATAAAGTGTTCAAAATAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 14675479..14675683 | 285..81 | 1010 | 99.5 | Minus |
chr3R | 27901430 | chr3R | 14675735..14675817 | 81..1 | 350 | 97.6 | Minus |
chr3R | 27901430 | chr3R | 14675349..14675401 | 370..318 | 265 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 18851430..18851666 | 317..81 | 1185 | 100 | Minus |
3R | 32079331 | 3R | 18851718..18851798 | 81..1 | 405 | 100 | Minus |
3R | 32079331 | 3R | 18851304..18851376 | 390..318 | 365 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 18592261..18592497 | 317..81 | 1185 | 100 | Minus |
3R | 31820162 | 3R | 18592549..18592629 | 81..1 | 405 | 100 | Minus |
3R | 31820162 | 3R | 18592135..18592207 | 390..318 | 365 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14675335..14675401 | 318..389 | 93 | <- | Minus |
chr3R | 14675455..14675683 | 81..317 | 95 | <- | Minus |
chr3R | 14675736..14675817 | 1..80 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31226-RB | 1..159 | 97..255 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31226-RB | 1..159 | 97..255 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31226-RA | 1..159 | 97..255 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31226-RB | 1..159 | 97..255 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31226-RA | 1..159 | 97..255 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31226-RA | 7..395 | 1..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31226-RA | 7..395 | 1..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31226-RA | 1..389 | 1..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31226-RA | 7..395 | 1..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31226-RA | 1..389 | 1..389 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18851430..18851666 | 81..317 | 100 | <- | Minus |
3R | 18851719..18851798 | 1..80 | 100 | Minus | |
3R | 18851305..18851376 | 318..389 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18851430..18851666 | 81..317 | 100 | <- | Minus |
3R | 18851719..18851798 | 1..80 | 100 | Minus | |
3R | 18851305..18851376 | 318..389 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18851430..18851666 | 81..317 | 100 | <- | Minus |
3R | 18851719..18851798 | 1..80 | 100 | Minus | |
3R | 18851305..18851376 | 318..389 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14677027..14677098 | 318..389 | 100 | <- | Minus |
arm_3R | 14677152..14677388 | 81..317 | 100 | <- | Minus |
arm_3R | 14677441..14677520 | 1..80 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18592261..18592497 | 81..317 | 100 | <- | Minus |
3R | 18592550..18592629 | 1..80 | 100 | Minus | |
3R | 18592136..18592207 | 318..389 | 100 | <- | Minus |
Translation from 96 to 254
> AT26083.pep MCSYPCYPCAALCPCGGSGPSGFYDPCFGPYNGPFNSWCGASGPGFWRGG CC*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15485-PA | 41 | GF15485-PA | 1..40 | 1..40 | 183 | 95 | Plus |
Dana\GF19672-PA | 53 | GF19672-PA | 3..53 | 2..52 | 176 | 78.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16310-PA | 52 | GG16310-PA | 1..52 | 1..52 | 247 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10780-PA | 52 | GH10780-PA | 1..52 | 1..52 | 159 | 69.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31226-PB | 52 | CG31226-PB | 1..52 | 1..52 | 341 | 100 | Plus |
CG31226-PA | 52 | CG31226-PA | 1..52 | 1..52 | 341 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18320-PA | 52 | GI18320-PA | 1..52 | 1..52 | 135 | 59.6 | Plus |
Dmoj\GI21870-PA | 52 | GI21870-PA | 1..52 | 1..52 | 135 | 59.6 | Plus |
Dmoj\GI21409-PA | 52 | GI21409-PA | 1..52 | 1..52 | 135 | 59.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25794-PA | 52 | GL25794-PA | 1..52 | 1..52 | 218 | 90.4 | Plus |
Dper\GL26691-PA | 52 | GL26691-PA | 1..49 | 1..49 | 181 | 81.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25450-PA | 52 | GA25450-PA | 1..52 | 1..52 | 218 | 90.4 | Plus |
Dpse\GA29020-PA | 52 | GA29020-PA | 1..49 | 1..49 | 181 | 81.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18678-PA | 52 | GM18678-PA | 1..52 | 1..52 | 247 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20149-PA | 52 | GD20149-PA | 1..52 | 1..52 | 247 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18386-PA | 52 | GJ18386-PA | 1..52 | 1..52 | 155 | 65.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19377-PA | 52 | GK19377-PA | 1..52 | 1..52 | 188 | 80.8 | Plus |
Translation from 96 to 254
> AT26083.hyp MCSYPCYPCAALCPCGGSGPSGFYDPCFGPYNGPFNSWCGASGPGFWRGG CC*