Clone AT26083 Report

Search the DGRC for AT26083

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:260
Well:83
Vector:pOTB7
Associated Gene/TranscriptCG31226-RA
Protein status:AT26083.pep: gold
Sequenced Size:427

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31226 2001-12-16 Blastp of sequenced clone
CG18208 2002-01-01 Sim4 clustering to Release 2
CG31226 2003-01-01 Sim4 clustering to Release 3
CG31226 2008-04-29 Release 5.5 accounting
CG31226 2008-08-15 Release 5.9 accounting
CG31226 2008-12-18 5.12 accounting

Clone Sequence Records

AT26083.complete Sequence

427 bp (427 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070822

> AT26083.complete
AATTCGTACTCTTCGGACGGTAACGGAACAAAAAATTCCTAAATAAATTT
CCTAGTTTTTTTTCCGGCAAAACAAGTAACGACAAATCAATTCACCATGT
GCAGCTATCCTTGCTATCCTTGCGCCGCCTTGTGTCCCTGCGGAGGCAGT
GGACCAAGTGGATTCTACGATCCGTGCTTTGGACCCTACAACGGACCATT
TAACTCCTGGTGCGGAGCAAGTGGACCCGGTTTCTGGAGAGGTGGATGTT
GCTAGTTTTTGTCATGAGCTGTAGGATTGAGCTACTTTCTCACACGGAAA
AATTGGAATTGCTGAACATCTCTTGCAAGGAAACTAAATTACCGTCCCAC
ATGAAGAGAGAAATGTTAATTAAATAAAGTGTTCAAAATAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAA

AT26083.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG31226-RA 459 CG31226-RA 50..439 1..390 1950 100 Plus
CG31226-RB 454 CG31226-RB 50..434 1..390 1850 98.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14675479..14675683 285..81 1010 99.5 Minus
chr3R 27901430 chr3R 14675735..14675817 81..1 350 97.6 Minus
chr3R 27901430 chr3R 14675349..14675401 370..318 265 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:59:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18851430..18851666 317..81 1185 100 Minus
3R 32079331 3R 18851718..18851798 81..1 405 100 Minus
3R 32079331 3R 18851304..18851376 390..318 365 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18592261..18592497 317..81 1185 100 Minus
3R 31820162 3R 18592549..18592629 81..1 405 100 Minus
3R 31820162 3R 18592135..18592207 390..318 365 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:34:26 has no hits.

AT26083.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:35:34 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14675335..14675401 318..389 93 <- Minus
chr3R 14675455..14675683 81..317 95 <- Minus
chr3R 14675736..14675817 1..80 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:22:17 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RB 1..159 97..255 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:47 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RB 1..159 97..255 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:52:11 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 1..159 97..255 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:18 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RB 1..159 97..255 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:57:05 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 1..159 97..255 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:28:15 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 7..395 1..389 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:46 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 7..395 1..389 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:52:11 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 1..389 1..389 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:19 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 7..395 1..389 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:57:05 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
CG31226-RA 1..389 1..389 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:35:34 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18851430..18851666 81..317 100 <- Minus
3R 18851719..18851798 1..80 100   Minus
3R 18851305..18851376 318..389 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:35:34 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18851430..18851666 81..317 100 <- Minus
3R 18851719..18851798 1..80 100   Minus
3R 18851305..18851376 318..389 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:35:34 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18851430..18851666 81..317 100 <- Minus
3R 18851719..18851798 1..80 100   Minus
3R 18851305..18851376 318..389 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:52:11 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14677027..14677098 318..389 100 <- Minus
arm_3R 14677152..14677388 81..317 100 <- Minus
arm_3R 14677441..14677520 1..80 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:02:02 Download gff for AT26083.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18592261..18592497 81..317 100 <- Minus
3R 18592550..18592629 1..80 100   Minus
3R 18592136..18592207 318..389 100 <- Minus

AT26083.pep Sequence

Translation from 96 to 254

> AT26083.pep
MCSYPCYPCAALCPCGGSGPSGFYDPCFGPYNGPFNSWCGASGPGFWRGG
CC*

AT26083.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15485-PA 41 GF15485-PA 1..40 1..40 183 95 Plus
Dana\GF19672-PA 53 GF19672-PA 3..53 2..52 176 78.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16310-PA 52 GG16310-PA 1..52 1..52 247 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10780-PA 52 GH10780-PA 1..52 1..52 159 69.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG31226-PB 52 CG31226-PB 1..52 1..52 341 100 Plus
CG31226-PA 52 CG31226-PA 1..52 1..52 341 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18320-PA 52 GI18320-PA 1..52 1..52 135 59.6 Plus
Dmoj\GI21870-PA 52 GI21870-PA 1..52 1..52 135 59.6 Plus
Dmoj\GI21409-PA 52 GI21409-PA 1..52 1..52 135 59.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:19:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25794-PA 52 GL25794-PA 1..52 1..52 218 90.4 Plus
Dper\GL26691-PA 52 GL26691-PA 1..49 1..49 181 81.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25450-PA 52 GA25450-PA 1..52 1..52 218 90.4 Plus
Dpse\GA29020-PA 52 GA29020-PA 1..49 1..49 181 81.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18678-PA 52 GM18678-PA 1..52 1..52 247 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20149-PA 52 GD20149-PA 1..52 1..52 247 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18386-PA 52 GJ18386-PA 1..52 1..52 155 65.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19377-PA 52 GK19377-PA 1..52 1..52 188 80.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25168-PA 52 GE25168-PA 1..52 1..52 247 100 Plus
Dyak\GE11145-PA 52 GE11145-PA 1..52 1..52 247 100 Plus

AT26083.hyp Sequence

Translation from 96 to 254

> AT26083.hyp
MCSYPCYPCAALCPCGGSGPSGFYDPCFGPYNGPFNSWCGASGPGFWRGG
CC*

AT26083.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG31226-PB 52 CG31226-PB 1..52 1..52 341 100 Plus
CG31226-PA 52 CG31226-PA 1..52 1..52 341 100 Plus