Clone AT26258 Report

Search the DGRC for AT26258

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:262
Well:58
Vector:pOTB7
Associated Gene/TranscriptCG14346-RA
Protein status:AT26258.pep: gold
Sequenced Size:749

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14346 2003-01-01 Sim4 clustering to Release 3
CG14346 2004-01-31 Blastp of sequenced clone
CG14346 2008-04-29 Release 5.5 accounting
CG14346 2008-08-15 Release 5.9 accounting
CG14346 2008-12-18 5.12 accounting

Clone Sequence Records

AT26258.complete Sequence

749 bp (749 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011558

> AT26258.complete
CTGTGTAGTGTCAAAAAGTCAAAATCATGTTCCTGGACGACTTTGGAAAT
CCAAAGGAGGTGACTCCCGAAACCCTGAGCACTTACACATACGATCTGCA
TGGCACCAAGCTGCTGACATCGGCGGACACCGAGATTTACCTGCCGCCGA
TGTGGCATGGCACGATTTACAGCACTGAAAAGCTGCTGGACACCTACAAG
AGGCGGTTCAATCCGGATCCAACTCTGCTGACCTTCCACGCCATGCAGCC
GTACGAACCCGAGTTCATTTGCGTCCAACGGACTGTGATCGAGCTAACGC
TCCTTCCGGCTGGTCAGAGCCTCTACAGCGACAAGGACATCGTCGTGTTC
CTGATCAAGCAGCCCGCCGAGATGAAAAACTCGCTGGTCACAAAGGAACT
GAGCACGCTGCTGGACTTCTTTCCGCACAACCACCACTACCACTCGATAA
TCATGAACGAGGGCATCGATGTAGTCTACGTGGACGACAAGATCTACAAC
AATATATCGCCCACCAGTCACCAGTTCCACCGCCTGTACAATTTGCTTCG
AAATATCCAGCCGGACGACGTGCAGAGCCTCTCGGGTTCTCCATTGCCCG
ATGTGCTGCGCAGTGCCTGCAGGAAGGCAGCCCACAAGACCAAGTAGTCG
CACTGAAACTCAACCTCCTCCCACGGAACTGTGTGCCTCCAAAACATTGT
TATAGTCCGGTTTAATAAACTTTGTGACTGCAGAAAAAAAAAAAAAAAA

AT26258.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG14346.a 862 CG14346.a 104..838 1..735 3675 100 Plus
CG14346-RA 967 CG14346-RA 209..943 1..735 3675 100 Plus
CG14346-RB 836 CG14346-RB 355..836 249..730 2410 100 Plus
CG14346-RB 836 CG14346-RB 143..357 1..215 1075 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1368388..1368909 213..733 2530 99.4 Plus
chr2L 23010047 chr2L 1368223..1368337 98..212 575 100 Plus
chr2L 23010047 chr2L 1368074..1368171 1..98 460 98 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:59:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1368530..1369052 213..735 2615 100 Plus
2L 23513712 2L 1368365..1368479 98..212 575 100 Plus
2L 23513712 2L 1368216..1368313 1..98 490 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1368530..1369052 213..735 2615 100 Plus
2L 23513712 2L 1368365..1368479 98..212 575 100 Plus
2L 23513712 2L 1368216..1368313 1..98 490 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:10:07 has no hits.

AT26258.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:10:57 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1368224..1368337 99..212 100 -> Plus
chr2L 1368074..1368171 1..98 97 -> Plus
chr2L 1368388..1368909 213..733 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:22:31 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
CG14346-RA 1..621 27..647 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:48 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
CG14346-RA 1..621 27..647 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:55:28 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
CG14346-RA 1..621 27..647 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:38 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
CG14346-RA 1..621 27..647 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:33:07 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
CG14346-RA 1..621 27..647 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:54 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
CG14346-RA 115..844 1..730 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:48 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
CG14346-RA 115..844 1..730 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:55:28 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
CG14346-RA 128..860 1..733 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:38 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
CG14346-RA 115..844 1..730 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:33:07 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
CG14346-RA 128..860 1..733 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:57 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1368216..1368313 1..98 100 -> Plus
2L 1368366..1368479 99..212 100 -> Plus
2L 1368530..1369050 213..733 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:57 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1368216..1368313 1..98 100 -> Plus
2L 1368366..1368479 99..212 100 -> Plus
2L 1368530..1369050 213..733 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:57 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1368216..1368313 1..98 100 -> Plus
2L 1368366..1368479 99..212 100 -> Plus
2L 1368530..1369050 213..733 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:55:28 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1368216..1368313 1..98 100 -> Plus
arm_2L 1368366..1368479 99..212 100 -> Plus
arm_2L 1368530..1369050 213..733 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:02:03 Download gff for AT26258.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1368530..1369050 213..733 100   Plus
2L 1368216..1368313 1..98 100 -> Plus
2L 1368366..1368479 99..212 100 -> Plus

AT26258.hyp Sequence

Translation from 26 to 646

> AT26258.hyp
MFLDDFGNPKEVTPETLSTYTYDLHGTKLLTSADTEIYLPPMWHGTIYST
EKLLDTYKRRFNPDPTLLTFHAMQPYEPEFICVQRTVIELTLLPAGQSLY
SDKDIVVFLIKQPAEMKNSLVTKELSTLLDFFPHNHHYHSIIMNEGIDVV
YVDDKIYNNISPTSHQFHRLYNLLRNIQPDDVQSLSGSPLPDVLRSACRK
AAHKTK*

AT26258.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG14346-PD 206 CG14346-PD 1..206 1..206 1096 100 Plus
CG14346-PC 206 CG14346-PC 1..206 1..206 1096 100 Plus
CG14346-PA 206 CG14346-PA 1..206 1..206 1096 100 Plus

AT26258.pep Sequence

Translation from 26 to 646

> AT26258.pep
MFLDDFGNPKEVTPETLSTYTYDLHGTKLLTSADTEIYLPPMWHGTIYST
EKLLDTYKRRFNPDPTLLTFHAMQPYEPEFICVQRTVIELTLLPAGQSLY
SDKDIVVFLIKQPAEMKNSLVTKELSTLLDFFPHNHHYHSIIMNEGIDVV
YVDDKIYNNISPTSHQFHRLYNLLRNIQPDDVQSLSGSPLPDVLRSACRK
AAHKTK*

AT26258.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15182-PA 209 GF15182-PA 1..206 1..206 814 70.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24790-PA 209 GG24790-PA 1..206 1..206 970 86.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG14346-PD 206 CG14346-PD 1..206 1..206 1096 100 Plus
CG14346-PC 206 CG14346-PC 1..206 1..206 1096 100 Plus
CG14346-PA 206 CG14346-PA 1..206 1..206 1096 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes133-PA 207 GI17088-PA 1..206 1..206 665 60.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15656-PA 219 GL15656-PA 1..212 1..199 644 56.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12923-PA 219 GA12923-PA 1..212 1..199 642 56.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16817-PA 206 GM16817-PA 1..206 1..206 1027 91.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23097-PA 208 GD23097-PA 1..206 1..206 1029 92.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10778-PA 207 GJ10778-PA 1..201 1..201 676 62.1 Plus
Dvir\GJ24296-PA 207 GJ24296-PA 1..197 1..198 184 29.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:36:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15193-PA 208 GK15193-PA 1..206 1..206 701 62.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:36:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17571-PA 137 GE17571-PA 1..134 73..206 594 82.8 Plus
Dyak\GE25061-PA 212 GE25061-PA 1..187 1..194 143 27.4 Plus