BDGP Sequence Production Resources |
Search the DGRC for AT26258
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 262 |
Well: | 58 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG14346-RA |
Protein status: | AT26258.pep: gold |
Sequenced Size: | 749 |
Gene | Date | Evidence |
---|---|---|
CG14346 | 2003-01-01 | Sim4 clustering to Release 3 |
CG14346 | 2004-01-31 | Blastp of sequenced clone |
CG14346 | 2008-04-29 | Release 5.5 accounting |
CG14346 | 2008-08-15 | Release 5.9 accounting |
CG14346 | 2008-12-18 | 5.12 accounting |
749 bp (749 high quality bases) assembled on 2004-01-31
GenBank Submission: BT011558
> AT26258.complete CTGTGTAGTGTCAAAAAGTCAAAATCATGTTCCTGGACGACTTTGGAAAT CCAAAGGAGGTGACTCCCGAAACCCTGAGCACTTACACATACGATCTGCA TGGCACCAAGCTGCTGACATCGGCGGACACCGAGATTTACCTGCCGCCGA TGTGGCATGGCACGATTTACAGCACTGAAAAGCTGCTGGACACCTACAAG AGGCGGTTCAATCCGGATCCAACTCTGCTGACCTTCCACGCCATGCAGCC GTACGAACCCGAGTTCATTTGCGTCCAACGGACTGTGATCGAGCTAACGC TCCTTCCGGCTGGTCAGAGCCTCTACAGCGACAAGGACATCGTCGTGTTC CTGATCAAGCAGCCCGCCGAGATGAAAAACTCGCTGGTCACAAAGGAACT GAGCACGCTGCTGGACTTCTTTCCGCACAACCACCACTACCACTCGATAA TCATGAACGAGGGCATCGATGTAGTCTACGTGGACGACAAGATCTACAAC AATATATCGCCCACCAGTCACCAGTTCCACCGCCTGTACAATTTGCTTCG AAATATCCAGCCGGACGACGTGCAGAGCCTCTCGGGTTCTCCATTGCCCG ATGTGCTGCGCAGTGCCTGCAGGAAGGCAGCCCACAAGACCAAGTAGTCG CACTGAAACTCAACCTCCTCCCACGGAACTGTGTGCCTCCAAAACATTGT TATAGTCCGGTTTAATAAACTTTGTGACTGCAGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14346.a | 862 | CG14346.a | 104..838 | 1..735 | 3675 | 100 | Plus |
CG14346-RA | 967 | CG14346-RA | 209..943 | 1..735 | 3675 | 100 | Plus |
CG14346-RB | 836 | CG14346-RB | 355..836 | 249..730 | 2410 | 100 | Plus |
CG14346-RB | 836 | CG14346-RB | 143..357 | 1..215 | 1075 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 1368388..1368909 | 213..733 | 2530 | 99.4 | Plus |
chr2L | 23010047 | chr2L | 1368223..1368337 | 98..212 | 575 | 100 | Plus |
chr2L | 23010047 | chr2L | 1368074..1368171 | 1..98 | 460 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 1368224..1368337 | 99..212 | 100 | -> | Plus |
chr2L | 1368074..1368171 | 1..98 | 97 | -> | Plus |
chr2L | 1368388..1368909 | 213..733 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14346-RA | 1..621 | 27..647 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14346-RA | 1..621 | 27..647 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14346-RA | 1..621 | 27..647 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14346-RA | 1..621 | 27..647 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14346-RA | 1..621 | 27..647 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14346-RA | 115..844 | 1..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14346-RA | 115..844 | 1..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14346-RA | 128..860 | 1..733 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14346-RA | 115..844 | 1..730 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14346-RA | 128..860 | 1..733 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1368216..1368313 | 1..98 | 100 | -> | Plus |
2L | 1368366..1368479 | 99..212 | 100 | -> | Plus |
2L | 1368530..1369050 | 213..733 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1368216..1368313 | 1..98 | 100 | -> | Plus |
2L | 1368366..1368479 | 99..212 | 100 | -> | Plus |
2L | 1368530..1369050 | 213..733 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1368216..1368313 | 1..98 | 100 | -> | Plus |
2L | 1368366..1368479 | 99..212 | 100 | -> | Plus |
2L | 1368530..1369050 | 213..733 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 1368216..1368313 | 1..98 | 100 | -> | Plus |
arm_2L | 1368366..1368479 | 99..212 | 100 | -> | Plus |
arm_2L | 1368530..1369050 | 213..733 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1368530..1369050 | 213..733 | 100 | Plus | |
2L | 1368216..1368313 | 1..98 | 100 | -> | Plus |
2L | 1368366..1368479 | 99..212 | 100 | -> | Plus |
Translation from 26 to 646
> AT26258.hyp MFLDDFGNPKEVTPETLSTYTYDLHGTKLLTSADTEIYLPPMWHGTIYST EKLLDTYKRRFNPDPTLLTFHAMQPYEPEFICVQRTVIELTLLPAGQSLY SDKDIVVFLIKQPAEMKNSLVTKELSTLLDFFPHNHHYHSIIMNEGIDVV YVDDKIYNNISPTSHQFHRLYNLLRNIQPDDVQSLSGSPLPDVLRSACRK AAHKTK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14346-PD | 206 | CG14346-PD | 1..206 | 1..206 | 1096 | 100 | Plus |
CG14346-PC | 206 | CG14346-PC | 1..206 | 1..206 | 1096 | 100 | Plus |
CG14346-PA | 206 | CG14346-PA | 1..206 | 1..206 | 1096 | 100 | Plus |
Translation from 26 to 646
> AT26258.pep MFLDDFGNPKEVTPETLSTYTYDLHGTKLLTSADTEIYLPPMWHGTIYST EKLLDTYKRRFNPDPTLLTFHAMQPYEPEFICVQRTVIELTLLPAGQSLY SDKDIVVFLIKQPAEMKNSLVTKELSTLLDFFPHNHHYHSIIMNEGIDVV YVDDKIYNNISPTSHQFHRLYNLLRNIQPDDVQSLSGSPLPDVLRSACRK AAHKTK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15182-PA | 209 | GF15182-PA | 1..206 | 1..206 | 814 | 70.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24790-PA | 209 | GG24790-PA | 1..206 | 1..206 | 970 | 86.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14346-PD | 206 | CG14346-PD | 1..206 | 1..206 | 1096 | 100 | Plus |
CG14346-PC | 206 | CG14346-PC | 1..206 | 1..206 | 1096 | 100 | Plus |
CG14346-PA | 206 | CG14346-PA | 1..206 | 1..206 | 1096 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\Tes133-PA | 207 | GI17088-PA | 1..206 | 1..206 | 665 | 60.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15656-PA | 219 | GL15656-PA | 1..212 | 1..199 | 644 | 56.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12923-PA | 219 | GA12923-PA | 1..212 | 1..199 | 642 | 56.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16817-PA | 206 | GM16817-PA | 1..206 | 1..206 | 1027 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23097-PA | 208 | GD23097-PA | 1..206 | 1..206 | 1029 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10778-PA | 207 | GJ10778-PA | 1..201 | 1..201 | 676 | 62.1 | Plus |
Dvir\GJ24296-PA | 207 | GJ24296-PA | 1..197 | 1..198 | 184 | 29.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15193-PA | 208 | GK15193-PA | 1..206 | 1..206 | 701 | 62.1 | Plus |