Clone AT26381 Report

Search the DGRC for AT26381

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:263
Well:81
Vector:pOTB7
Associated Gene/Transcriptl(1)G0136-RA
Protein status:AT26381.pep: gold
Preliminary Size:482
Sequenced Size:787

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8198 2002-01-01 Sim4 clustering to Release 2
CG8198 2002-02-22 Blastp of sequenced clone
CG8198 2003-01-01 Sim4 clustering to Release 3
l(1)G0136 2008-04-29 Release 5.5 accounting
l(1)G0136 2008-08-15 Release 5.9 accounting
l(1)G0136 2008-12-18 5.12 accounting

Clone Sequence Records

AT26381.complete Sequence

787 bp (787 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089446

> AT26381.complete
ATCGACCATCTGGTAGTAAGCACTCATATTTTCGAATTTTTTTTGTGGAA
ATTCTCGAGTCAAACAAATTATATAAAGGGCACGAACCGATGGCGACACG
TGTGGTGGCAACGGCGACAGTGCGGGCGGTGAAAGGCCGGAAGTTAATCC
CGACGCGGGCCGCTCTGACTCTGACACCCGCGGCGGTGCTACGCATCAAG
ACGCTTCTGCAGGACAAGCCGGACATGGTTGGCCTAAAGGTGGGCGTACG
GCAGCGAGGATGCAATGGTCTGTCCTACACGCTGGACTATGCCAGCCAAA
AAGACAAGTTGGATGAGGAGGTGGTCCAGGATGGCGTCAAGGTCTTCATC
GACAAGAAAGCGCAGTTGTCGCTGCTGGGTACCGAGATGGACTTTGTGGA
ATCGAAGCTGTCCAGCGAGTTCGTGTTTAACAATCCGAACATTAAGGGCA
CATGCGGCTGCGGCGAATCGTTCAGCATGTAAACCGATGGAGATCCGCCG
GCACCCGCCTCGCAGACAGACCTAAATTAACTAAGTTAAATGCAGTACGC
GGCCCGACCTTGTATCTCATTACGTTGTTGGCAAAAGCACCGCATCCTTT
GTAAATTTTACTTCGCAAACGAATTCTAAATATTAAGTTGTGTTCTATAG
TTAAATTTTAGTTGTAGCGCTAGGTAAGTGACGCACCCGCTTCCTTGCCG
CAGGCTGGCAGTTTGTCCTCTTTAGCCCTAGTTCAATATATAGACAAGGA
ATGTTCTAGAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT26381.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0136-RA 924 l(1)G0136-RA 107..603 1..497 2485 100 Plus
l(1)G0136-RA 924 l(1)G0136-RA 606..880 489..763 1375 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15625224..15625616 378..759 1765 97.2 Plus
chrX 22417052 chrX 15624116..15624288 1..173 865 100 Plus
chrX 22417052 chrX 15625081..15625160 302..381 400 100 Plus
chrX 22417052 chrX 15624934..15625010 227..303 385 100 Plus
chrX 22417052 chrX 15624388..15624444 173..229 285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:59:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15735388..15735784 378..763 1785 97.2 Plus
X 23542271 X 15734280..15734452 1..173 865 100 Plus
X 23542271 X 15735245..15735324 302..381 400 100 Plus
X 23542271 X 15735098..15735174 227..303 385 100 Plus
X 23542271 X 15734552..15734608 173..229 285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15743608..15743882 489..763 1375 100 Plus
X 23527363 X 15742378..15742550 1..173 865 100 Plus
X 23527363 X 15743486..15743605 378..497 600 100 Plus
X 23527363 X 15743343..15743422 302..381 400 100 Plus
X 23527363 X 15743196..15743272 227..303 385 100 Plus
X 23527363 X 15742650..15742706 173..229 285 100 Plus
Blast to na_te.dros performed 2019-03-16 17:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2..64 657..592 115 70.1 Minus

AT26381.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:19:35 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15624116..15624288 1..173 100 -> Plus
chrX 15624389..15624442 174..227 100 -> Plus
chrX 15624935..15625010 228..303 100 -> Plus
chrX 15625083..15625157 304..378 100 -> Plus
chrX 15625225..15625616 379..759 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:22:50 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 1..393 90..482 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:41:04 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 1..393 90..482 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:54:28 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 1..393 90..482 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:10:24 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 1..393 90..482 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:56:40 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 1..393 90..482 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:05:55 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 1..770 1..759 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:41:04 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 1..770 1..759 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:54:28 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 11..780 1..759 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:10:24 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 1..770 1..759 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:56:40 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 11..780 1..759 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:19:35 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
X 15734280..15734452 1..173 100 -> Plus
X 15734553..15734606 174..227 100 -> Plus
X 15735099..15735174 228..303 100 -> Plus
X 15735247..15735321 304..378 100 -> Plus
X 15735389..15735780 379..759 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:19:35 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
X 15734280..15734452 1..173 100 -> Plus
X 15734553..15734606 174..227 100 -> Plus
X 15735099..15735174 228..303 100 -> Plus
X 15735247..15735321 304..378 100 -> Plus
X 15735389..15735780 379..759 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:19:35 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
X 15734280..15734452 1..173 100 -> Plus
X 15734553..15734606 174..227 100 -> Plus
X 15735099..15735174 228..303 100 -> Plus
X 15735247..15735321 304..378 100 -> Plus
X 15735389..15735780 379..759 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:54:28 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15628313..15628485 1..173 100 -> Plus
arm_X 15628586..15628639 174..227 100 -> Plus
arm_X 15629132..15629207 228..303 100 -> Plus
arm_X 15629280..15629354 304..378 100 -> Plus
arm_X 15629422..15629813 379..759 97   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:44:43 Download gff for AT26381.complete
Subject Subject Range Query Range Percent Splice Strand
X 15743487..15743878 379..759 97   Plus
X 15742378..15742550 1..173 100 -> Plus
X 15742651..15742704 174..227 100 -> Plus
X 15743197..15743272 228..303 100 -> Plus
X 15743345..15743419 304..378 100 -> Plus

AT26381.hyp Sequence

Translation from 2 to 481

> AT26381.hyp
RPSGSKHSYFRIFFVEILESNKLYKGHEPMATRVVATATVRAVKGRKLIP
TRAALTLTPAAVLRIKTLLQDKPDMVGLKVGVRQRGCNGLSYTLDYASQK
DKLDEEVVQDGVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGT
CGCGESFSM*

AT26381.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0136-PA 130 CG8198-PA 1..130 30..159 651 100 Plus
l(1)G0136-PB 131 CG8198-PB 1..131 30..159 639 99.2 Plus

AT26381.pep Sequence

Translation from 89 to 481

> AT26381.pep
MATRVVATATVRAVKGRKLIPTRAALTLTPAAVLRIKTLLQDKPDMVGLK
VGVRQRGCNGLSYTLDYASQKDKLDEEVVQDGVKVFIDKKAQLSLLGTEM
DFVESKLSSEFVFNNPNIKGTCGCGESFSM*

AT26381.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21925-PA 130 GF21925-PA 1..130 1..130 671 99.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17904-PA 130 GG17904-PA 1..130 1..130 677 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24545-PA 130 GH24545-PA 1..130 1..130 631 92.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
MagR-PA 130 CG8198-PA 1..130 1..130 651 100 Plus
MagR-PB 131 CG8198-PB 1..131 1..130 639 99.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16259-PA 130 GI16259-PA 1..130 1..130 649 95.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16489-PA 130 GL16489-PA 1..130 1..130 650 95.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20890-PA 130 GA20890-PA 1..130 1..130 650 95.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22570-PA 130 GM22570-PA 1..130 1..130 677 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17232-PA 125 GD17232-PA 1..125 6..130 652 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16900-PA 130 GJ16900-PA 1..130 1..130 636 93.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25017-PA 130 GK25017-PA 1..130 1..130 651 95.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17212-PA 130 GE17212-PA 1..130 1..130 677 100 Plus