BDGP Sequence Production Resources |
Search the DGRC for AT26381
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 263 |
Well: | 81 |
Vector: | pOTB7 |
Associated Gene/Transcript | l(1)G0136-RA |
Protein status: | AT26381.pep: gold |
Preliminary Size: | 482 |
Sequenced Size: | 787 |
Gene | Date | Evidence |
---|---|---|
CG8198 | 2002-01-01 | Sim4 clustering to Release 2 |
CG8198 | 2002-02-22 | Blastp of sequenced clone |
CG8198 | 2003-01-01 | Sim4 clustering to Release 3 |
l(1)G0136 | 2008-04-29 | Release 5.5 accounting |
l(1)G0136 | 2008-08-15 | Release 5.9 accounting |
l(1)G0136 | 2008-12-18 | 5.12 accounting |
787 bp (787 high quality bases) assembled on 2002-02-22
GenBank Submission: AY089446
> AT26381.complete ATCGACCATCTGGTAGTAAGCACTCATATTTTCGAATTTTTTTTGTGGAA ATTCTCGAGTCAAACAAATTATATAAAGGGCACGAACCGATGGCGACACG TGTGGTGGCAACGGCGACAGTGCGGGCGGTGAAAGGCCGGAAGTTAATCC CGACGCGGGCCGCTCTGACTCTGACACCCGCGGCGGTGCTACGCATCAAG ACGCTTCTGCAGGACAAGCCGGACATGGTTGGCCTAAAGGTGGGCGTACG GCAGCGAGGATGCAATGGTCTGTCCTACACGCTGGACTATGCCAGCCAAA AAGACAAGTTGGATGAGGAGGTGGTCCAGGATGGCGTCAAGGTCTTCATC GACAAGAAAGCGCAGTTGTCGCTGCTGGGTACCGAGATGGACTTTGTGGA ATCGAAGCTGTCCAGCGAGTTCGTGTTTAACAATCCGAACATTAAGGGCA CATGCGGCTGCGGCGAATCGTTCAGCATGTAAACCGATGGAGATCCGCCG GCACCCGCCTCGCAGACAGACCTAAATTAACTAAGTTAAATGCAGTACGC GGCCCGACCTTGTATCTCATTACGTTGTTGGCAAAAGCACCGCATCCTTT GTAAATTTTACTTCGCAAACGAATTCTAAATATTAAGTTGTGTTCTATAG TTAAATTTTAGTTGTAGCGCTAGGTAAGTGACGCACCCGCTTCCTTGCCG CAGGCTGGCAGTTTGTCCTCTTTAGCCCTAGTTCAATATATAGACAAGGA ATGTTCTAGAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 15625224..15625616 | 378..759 | 1765 | 97.2 | Plus |
chrX | 22417052 | chrX | 15624116..15624288 | 1..173 | 865 | 100 | Plus |
chrX | 22417052 | chrX | 15625081..15625160 | 302..381 | 400 | 100 | Plus |
chrX | 22417052 | chrX | 15624934..15625010 | 227..303 | 385 | 100 | Plus |
chrX | 22417052 | chrX | 15624388..15624444 | 173..229 | 285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 15735388..15735784 | 378..763 | 1785 | 97.2 | Plus |
X | 23542271 | X | 15734280..15734452 | 1..173 | 865 | 100 | Plus |
X | 23542271 | X | 15735245..15735324 | 302..381 | 400 | 100 | Plus |
X | 23542271 | X | 15735098..15735174 | 227..303 | 385 | 100 | Plus |
X | 23542271 | X | 15734552..15734608 | 173..229 | 285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 15743608..15743882 | 489..763 | 1375 | 100 | Plus |
X | 23527363 | X | 15742378..15742550 | 1..173 | 865 | 100 | Plus |
X | 23527363 | X | 15743486..15743605 | 378..497 | 600 | 100 | Plus |
X | 23527363 | X | 15743343..15743422 | 302..381 | 400 | 100 | Plus |
X | 23527363 | X | 15743196..15743272 | 227..303 | 385 | 100 | Plus |
X | 23527363 | X | 15742650..15742706 | 173..229 | 285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2..64 | 657..592 | 115 | 70.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 15624116..15624288 | 1..173 | 100 | -> | Plus |
chrX | 15624389..15624442 | 174..227 | 100 | -> | Plus |
chrX | 15624935..15625010 | 228..303 | 100 | -> | Plus |
chrX | 15625083..15625157 | 304..378 | 100 | -> | Plus |
chrX | 15625225..15625616 | 379..759 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0136-RA | 1..393 | 90..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0136-RA | 1..393 | 90..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0136-RA | 1..393 | 90..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0136-RA | 1..393 | 90..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0136-RA | 1..393 | 90..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0136-RA | 1..770 | 1..759 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0136-RA | 1..770 | 1..759 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0136-RA | 11..780 | 1..759 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0136-RA | 1..770 | 1..759 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0136-RA | 11..780 | 1..759 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 15734280..15734452 | 1..173 | 100 | -> | Plus |
X | 15734553..15734606 | 174..227 | 100 | -> | Plus |
X | 15735099..15735174 | 228..303 | 100 | -> | Plus |
X | 15735247..15735321 | 304..378 | 100 | -> | Plus |
X | 15735389..15735780 | 379..759 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 15734280..15734452 | 1..173 | 100 | -> | Plus |
X | 15734553..15734606 | 174..227 | 100 | -> | Plus |
X | 15735099..15735174 | 228..303 | 100 | -> | Plus |
X | 15735247..15735321 | 304..378 | 100 | -> | Plus |
X | 15735389..15735780 | 379..759 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 15734280..15734452 | 1..173 | 100 | -> | Plus |
X | 15734553..15734606 | 174..227 | 100 | -> | Plus |
X | 15735099..15735174 | 228..303 | 100 | -> | Plus |
X | 15735247..15735321 | 304..378 | 100 | -> | Plus |
X | 15735389..15735780 | 379..759 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 15628313..15628485 | 1..173 | 100 | -> | Plus |
arm_X | 15628586..15628639 | 174..227 | 100 | -> | Plus |
arm_X | 15629132..15629207 | 228..303 | 100 | -> | Plus |
arm_X | 15629280..15629354 | 304..378 | 100 | -> | Plus |
arm_X | 15629422..15629813 | 379..759 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 15743487..15743878 | 379..759 | 97 | Plus | |
X | 15742378..15742550 | 1..173 | 100 | -> | Plus |
X | 15742651..15742704 | 174..227 | 100 | -> | Plus |
X | 15743197..15743272 | 228..303 | 100 | -> | Plus |
X | 15743345..15743419 | 304..378 | 100 | -> | Plus |
Translation from 2 to 481
> AT26381.hyp RPSGSKHSYFRIFFVEILESNKLYKGHEPMATRVVATATVRAVKGRKLIP TRAALTLTPAAVLRIKTLLQDKPDMVGLKVGVRQRGCNGLSYTLDYASQK DKLDEEVVQDGVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGT CGCGESFSM*
Translation from 89 to 481
> AT26381.pep MATRVVATATVRAVKGRKLIPTRAALTLTPAAVLRIKTLLQDKPDMVGLK VGVRQRGCNGLSYTLDYASQKDKLDEEVVQDGVKVFIDKKAQLSLLGTEM DFVESKLSSEFVFNNPNIKGTCGCGESFSM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21925-PA | 130 | GF21925-PA | 1..130 | 1..130 | 671 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17904-PA | 130 | GG17904-PA | 1..130 | 1..130 | 677 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24545-PA | 130 | GH24545-PA | 1..130 | 1..130 | 631 | 92.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
MagR-PA | 130 | CG8198-PA | 1..130 | 1..130 | 651 | 100 | Plus |
MagR-PB | 131 | CG8198-PB | 1..131 | 1..130 | 639 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16259-PA | 130 | GI16259-PA | 1..130 | 1..130 | 649 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16489-PA | 130 | GL16489-PA | 1..130 | 1..130 | 650 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20890-PA | 130 | GA20890-PA | 1..130 | 1..130 | 650 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22570-PA | 130 | GM22570-PA | 1..130 | 1..130 | 677 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17232-PA | 125 | GD17232-PA | 1..125 | 6..130 | 652 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16900-PA | 130 | GJ16900-PA | 1..130 | 1..130 | 636 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25017-PA | 130 | GK25017-PA | 1..130 | 1..130 | 651 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17212-PA | 130 | GE17212-PA | 1..130 | 1..130 | 677 | 100 | Plus |