Clone AT26486 Report

Search the DGRC for AT26486

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:264
Well:86
Vector:pOTB7
Associated Gene/TranscriptCG2577-RA
Protein status:AT26486.pep: gold
Preliminary Size:1087
Sequenced Size:1249

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2577 2002-01-01 Sim4 clustering to Release 2
CG2577 2002-01-18 Blastp of sequenced clone
CG2577 2003-01-01 Sim4 clustering to Release 3
CG2577 2008-04-29 Release 5.5 accounting
CG2577 2008-08-15 Release 5.9 accounting
CG2577 2008-12-18 5.12 accounting

Clone Sequence Records

AT26486.complete Sequence

1249 bp (1249 high quality bases) assembled on 2002-01-18

GenBank Submission: AY089448

> AT26486.complete
CAGAGAACCGAGCCCGGAAAAAGAAAGCAGCACAATGGAACGACTGCGCT
CCTCCCAAAACCGCGAAGTGCGAATCGGCAACTATAAGGTGGTGCGCAAG
ATCGGCTGTGGATCCTTCGGCGATATATATCTGGGCATCTATATCCACAG
TGGGGAGCGGGTGGCCATCAAGGTGGAAAGCAGCAAGGTGCGCCATCCGC
AGCTCAACTACGAGAGGCGAATCTACCGCGCCCTGAGGCCCGCCCACGGT
TTGCCAAGGATTAGGTACTTCCACAAGGAGGAGCACTACCAGGCGATGGT
TATGGATCTGCTTGGTCCCTCGCTGGAGAGACTCTTTCAGTTCTGCGAAA
GGGCATTCACCATCAAGACCGTTCTGCTTCTGGCCGAACAGATGCTTCGC
CGGGTGGAGTATGTCCATAACCGGGGATTCCTGCACCGCGACATCAAGCC
GGATAACTTCCTGATGGGTCTGGGTACCATGTCCAAGCAAGTGTACCTCA
TCGATTTCGGGCTATCCAAGAAGTATCTGGACATAACCACTGGTGTCCAT
ATACCATATCGCGAGGAGCGTTCCTTGACGGGAACAGCCAGGTACGCCTC
CATTGGCGCCCATGCCGGCGTCGAATCCGCCAGAAGGGATGACATGGTGG
CCGTTGGCTATGTCCTTATGTACTTCAATCGGGGATCACTGCCGTGGCAG
GATTTAAAGGCGTCCACCAAGCAGCAGAAATATGAACGCATACATGAGAA
AAAGATCTCGGTAAGCATTGAGGTACTTTGCGAGGGATTTCCCTGCGAGT
TCACAATGTACTTAAACTACTGCCGCGGCATGGGATTCTACGATAAGCCC
AACTACGACTTCATCTGCCGCATGTTTCGGATGCTGCGGAATGGTCTCAA
TCTTCGGCCGGGTCTCATCTACGACTGGGACATGCTGATGATGAAGTTCC
ACAATACTCAGAAAAATCCTGGCATTGGAATGCGTGTATTTCCACCTAAA
CAGAAGGAAGATGATGGTATCAGCGGTGAGCCGATCATCAAAGATGAGAA
GTGCAACTTCTGGCCGTGAAAAATCCATAGAAATCGTCGAGTTTCGAGTA
AATTAATAGTCGAACTAAATTAATTAGTAGCCTGTAACTAGAATTACTCC
CCTCACAACTAATCATTATAAATTGCATGCATAAATAATTAGTGGGAGTA
TAAATTATAACGAAAAGTTAAATAAAGTATTAAAAAAAAAAAAAAAAAA

AT26486.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG2577-RA 1241 CG2577-RA 1..1235 1..1235 6175 100 Plus
dco-RB 3207 dco-RB 917..951 437..471 160 97.1 Plus
dco.b 3440 dco.b 917..951 437..471 160 97.1 Plus
dco-RB 3207 dco-RB 575..657 95..177 145 78.3 Plus
dco.b 3440 dco.b 575..657 95..177 145 78.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 12264113..12265343 1..1231 6155 100 Plus
chrX 22417052 chrX 12546557..12546669 356..468 190 77.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:59:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12373211..12374445 1..1235 6175 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 12381309..12382543 1..1235 6175 100 Plus
3R 31820162 3R 30798270..30798304 471..437 160 97.1 Minus
3R 31820162 3R 30798564..30798646 177..95 145 78.3 Minus
Blast to na_te.dros performed on 2019-03-16 19:42:54 has no hits.

AT26486.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:43:56 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 12264113..12265343 1..1231 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:23:03 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
CG2577-RA 1..1035 35..1069 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:45:57 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
CG2577-RA 1..1035 35..1069 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:46:04 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
CG2577-RA 1..1035 35..1069 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:14:25 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
CG2577-RA 1..1035 35..1069 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:40:27 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
CG2577-RA 1..1035 35..1069 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:10:20 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
CG2577-RA 1..1231 1..1231 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:45:57 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
CG2577-RA 1..1231 1..1231 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:46:04 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
CG2577-RA 94..1324 1..1231 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:14:25 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
CG2577-RA 1..1231 1..1231 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:40:27 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
CG2577-RA 94..1324 1..1231 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:56 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
X 12373211..12374441 1..1231 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:56 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
X 12373211..12374441 1..1231 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:56 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
X 12373211..12374441 1..1231 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:46:04 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 12267244..12268474 1..1231 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:48:06 Download gff for AT26486.complete
Subject Subject Range Query Range Percent Splice Strand
X 12381309..12382539 1..1231 100   Plus

AT26486.hyp Sequence

Translation from 1 to 1068

> AT26486.hyp
REPSPEKESSTMERLRSSQNREVRIGNYKVVRKIGCGSFGDIYLGIYIHS
GERVAIKVESSKVRHPQLNYERRIYRALRPAHGLPRIRYFHKEEHYQAMV
MDLLGPSLERLFQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKP
DNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYAS
IGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEK
KISVSIEVLCEGFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLN
LRPGLIYDWDMLMMKFHNTQKNPGIGMRVFPPKQKEDDGISGEPIIKDEK
CNFWP*

AT26486.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG2577-PA 344 CG2577-PA 1..344 12..355 1840 100 Plus
CkIalpha-PG 337 CG2028-PG 4..337 12..348 1002 56.7 Plus
CkIalpha-PF 337 CG2028-PF 4..337 12..348 1002 56.7 Plus
CkIalpha-PD 337 CG2028-PD 4..337 12..348 1002 56.7 Plus
CkIalpha-PE 337 CG2028-PE 4..337 12..348 1002 56.7 Plus

AT26486.pep Sequence

Translation from 34 to 1068

> AT26486.pep
MERLRSSQNREVRIGNYKVVRKIGCGSFGDIYLGIYIHSGERVAIKVESS
KVRHPQLNYERRIYRALRPAHGLPRIRYFHKEEHYQAMVMDLLGPSLERL
FQFCERAFTIKTVLLLAEQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTMS
KQVYLIDFGLSKKYLDITTGVHIPYREERSLTGTARYASIGAHAGVESAR
RDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSIEVLCE
GFPCEFTMYLNYCRGMGFYDKPNYDFICRMFRMLRNGLNLRPGLIYDWDM
LMMKFHNTQKNPGIGMRVFPPKQKEDDGISGEPIIKDEKCNFWP*

AT26486.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19391-PA 344 GF19391-PA 1..344 1..344 1649 87.5 Plus
Dana\GF21383-PA 337 GF21383-PA 4..337 1..337 1006 56.7 Plus
Dana\GF23293-PA 441 GF23293-PA 2..293 11..301 914 57.5 Plus
Dana\GF15092-PA 388 GF15092-PA 26..312 15..301 850 54.7 Plus
Dana\GF13879-PA 415 GF13879-PA 12..313 9..310 799 49.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17715-PA 344 GG17715-PA 1..343 1..343 1816 98 Plus
Dere\GG17734-PA 337 GG17734-PA 4..337 1..337 1006 56.7 Plus
Dere\GG11892-PA 440 GG11892-PA 2..314 11..332 915 54.2 Plus
Dere\GG21733-PA 394 GG21733-PA 25..321 15..311 881 53.5 Plus
Dere\GG11027-PA 484 GG11027-PA 74..359 15..301 756 49.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12595-PA 343 GH12595-PA 1..343 1..337 1000 54.8 Plus
Dgri\GH12114-PA 343 GH12114-PA 13..327 11..326 982 57.1 Plus
Dgri\GH17562-PA 345 GH17562-PA 1..344 1..343 981 52.9 Plus
Dgri\GH14346-PA 439 GH14346-PA 2..315 11..333 917 54 Plus
Dgri\GH18700-PA 340 GH18700-PA 1..301 1..301 852 51.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG2577-PA 344 CG2577-PA 1..344 1..344 1840 100 Plus
CkIalpha-PG 337 CG2028-PG 4..337 1..337 1002 56.7 Plus
CkIalpha-PF 337 CG2028-PF 4..337 1..337 1002 56.7 Plus
CkIalpha-PD 337 CG2028-PD 4..337 1..337 1002 56.7 Plus
CkIalpha-PE 337 CG2028-PE 4..337 1..337 1002 56.7 Plus
CkIalpha-PA 337 CG2028-PA 4..337 1..337 1002 56.7 Plus
CkIalpha-PB 337 CG2028-PB 4..337 1..337 1002 56.7 Plus
dco-PE 440 CG2048-PE 2..314 11..332 910 54.2 Plus
dco-PD 440 CG2048-PD 2..314 11..332 910 54.2 Plus
dco-PC 440 CG2048-PC 2..314 11..332 910 54.2 Plus
dco-PB 440 CG2048-PB 2..314 11..332 910 54.2 Plus
dco-PA 440 CG2048-PA 2..314 11..332 910 54.2 Plus
CG7094-PA 390 CG7094-PA 25..314 15..304 860 54.8 Plus
CG12147-PA 477 CG12147-PA 66..351 15..301 750 49.1 Plus
gish-PA 422 CG6963-PA 20..305 16..298 749 49.7 Plus
gish-PE 463 CG6963-PE 61..346 16..298 749 49.7 Plus
gish-PF 358 CG6963-PF 61..351 16..298 721 47.8 Plus
gish-PC 427 CG6963-PC 20..310 16..298 721 47.8 Plus
gish-PM 468 CG6963-PM 61..351 16..298 721 47.8 Plus
gish-PH 468 CG6963-PH 61..351 16..298 721 47.8 Plus
gish-PD 468 CG6963-PD 61..351 16..298 721 47.8 Plus
gish-PB 468 CG6963-PB 61..351 16..298 721 47.8 Plus
gish-PI 474 CG6963-PI 61..351 16..298 721 47.8 Plus
gish-PG 476 CG6963-PG 69..359 16..298 721 47.8 Plus
gish-PL 537 CG6963-PL 61..351 16..298 721 47.8 Plus
gish-PK 496 CG6963-PK 61..373 16..298 688 44.4 Plus
gish-PJ 521 CG6963-PJ 61..376 16..298 685 44 Plus
CG9962-PA 319 CG9962-PA 10..304 12..313 676 46 Plus
Asator-PF 811 CG11533-PF 17..294 17..299 403 34 Plus
Asator-PK 1106 CG11533-PK 17..294 17..299 403 34 Plus
Asator-PL 1106 CG11533-PL 17..294 17..299 403 34 Plus
Asator-PG 1144 CG11533-PG 173..450 17..299 403 34 Plus
Asator-PH 1193 CG11533-PH 17..294 17..299 403 34 Plus
Asator-PJ 1261 CG11533-PJ 172..449 17..299 403 34 Plus
Asator-PE 1262 CG11533-PE 173..450 17..299 403 34 Plus
Asator-PI 1348 CG11533-PI 172..449 17..299 403 34 Plus
Asator-PD 1349 CG11533-PD 173..450 17..299 403 34 Plus
ball-PB 599 CG6386-PB 45..322 15..275 206 27.5 Plus
ball-PA 599 CG6386-PA 45..322 15..275 206 27.5 Plus
CG8878-PC 1004 CG8878-PC 496..653 127..282 200 32.1 Plus
CG8878-PB 1004 CG8878-PB 496..653 127..282 200 32.1 Plus
CG8878-PA 1004 CG8878-PA 496..653 127..282 200 32.1 Plus
gskt-PA 501 CG31003-PA 32..185 16..165 159 32.3 Plus
PKD-PF 836 CG7125-PF 549..745 23..223 159 26.2 Plus
PKD-PE 836 CG7125-PE 549..745 23..223 159 26.2 Plus
PKD-PD 836 CG7125-PD 549..745 23..223 159 26.2 Plus
PKD-PC 836 CG7125-PC 549..745 23..223 159 26.2 Plus
PKD-PB 836 CG7125-PB 549..745 23..223 159 26.2 Plus
PKD-PA 836 CG7125-PA 549..745 23..223 159 26.2 Plus
PKD-PG 906 CG7125-PG 549..745 23..223 159 26.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16025-PA 344 GI16025-PA 1..343 1..343 1026 55.7 Plus
Dmoj\GI16225-PA 343 GI16225-PA 1..329 1..326 1002 56.8 Plus
Dmoj\GI16325-PA 343 GI16325-PA 20..329 17..327 989 57.6 Plus
Dmoj\GI22355-PA 379 GI22355-PA 25..311 15..301 808 50.2 Plus
Dmoj\GI23642-PA 380 GI23642-PA 26..308 15..298 767 50.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25396-PA 345 GL25396-PA 1..342 1..343 1350 72 Plus
Dper\GL13140-PA 288 GL13140-PA 4..287 1..284 927 60.6 Plus
Dper\GL15889-PA 374 GL15889-PA 32..352 15..344 848 46.4 Plus
Dper\GL21596-PA 468 GL21596-PA 61..351 16..298 731 48.1 Plus
Dper\GL13966-PA 404 GL13966-PA 2..279 11..301 707 48.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15396-PA 345 GA15396-PA 1..342 1..343 1347 71.7 Plus
Dpse\GA15193-PA 337 GA15193-PA 4..337 1..337 1007 56.7 Plus
Dpse\GA15205-PD 439 GA15205-PD 2..293 11..301 917 57.5 Plus
Dpse\GA15205-PB 439 GA15205-PB 2..293 11..301 917 57.5 Plus
Dpse\GA20096-PA 374 GA20096-PA 32..318 15..301 848 50.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11559-PA 344 GM11559-PA 1..344 1..344 1832 99.1 Plus
Dsec\GM11579-PA 337 GM11579-PA 4..337 1..337 1004 56.4 Plus
Dsec\GM12110-PA 440 GM12110-PA 2..314 11..332 915 54.2 Plus
Dsec\GM17114-PA 379 GM17114-PA 25..314 15..304 875 54.8 Plus
Dsec\GM15143-PA 476 GM15143-PA 69..345 16..284 726 49.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:09:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17076-PA 344 GD17076-PA 1..344 1..344 1831 98.8 Plus
Dsim\GD16644-PA 395 GD16644-PA 2..314 11..332 914 54.2 Plus
Dsim\GD19086-PA 476 GD19086-PA 69..345 16..284 726 49.5 Plus
Dsim\GD22814-PA 319 GD22814-PA 10..304 12..313 715 48 Plus
Dsim\GD24797-PA 157 GD24797-PA 4..149 1..146 466 60.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16877-PA 344 GJ16877-PA 1..344 1..344 1116 58.7 Plus
Dvir\GJ15916-PA 343 GJ15916-PA 5..343 3..337 997 56 Plus
Dvir\GJ15665-PA 343 GJ15665-PA 8..329 6..327 992 56.7 Plus
Dvir\GJ10658-PA 443 GJ10658-PA 2..293 11..301 910 57.2 Plus
Dvir\GJ21295-PA 379 GJ21295-PA 25..316 15..310 800 49 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19238-PA 334 GK19238-PA 1..334 1..335 1087 60.3 Plus
Dwil\GK25517-PA 337 GK25517-PA 1..337 1..337 1016 56.5 Plus
Dwil\GK22559-PA 425 GK22559-PA 2..319 11..337 928 54 Plus
Dwil\GK24490-PA 325 GK24490-PA 14..301 14..301 825 55.6 Plus
Dwil\GK18163-PA 397 GK18163-PA 25..314 15..304 825 50.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17004-PA 340 GE17004-PA 1..340 1..344 1608 88.3 Plus
Dyak\GE17024-PA 337 GE17024-PA 4..337 1..337 1007 56.7 Plus
Dyak\GE23340-PA 440 GE23340-PA 2..314 11..332 915 54.2 Plus
Dyak\GE13122-PA 390 GE13122-PA 25..314 15..304 863 54.1 Plus
Dyak\GE25283-PA 480 GE25283-PA 72..357 15..301 752 49.3 Plus