Clone AT26877 Report

Search the DGRC for AT26877

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:268
Well:77
Vector:pOTB7
Associated Gene/TranscriptCG4686-RA
Protein status:AT26877.pep: gold
Sequenced Size:905

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4686-RA 2009-01-21 est gleaning
CG4686 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

AT26877.complete Sequence

905 bp assembled on 2009-08-10

GenBank Submission: BT099530.1

> AT26877.complete
CCAAACAAAGTTTGAGCAAACAATACACAATGTCAGTCGCTGACACCATT
GAATACGTGACCCTGGGCAATCCTGTCAGCAAGATGGTAGCCTCGTCCGC
ATCCGCCCTGCTCCGCACGCTTGGTCTGCGTCCCAAGAAGGTGCCGGTGC
AGGAGACGAGTATGGCGGTGCTCCCTGCCGCCCACAGCTACGCGCATTCA
CACGGATCACTCTATCGACTGGCCGGCTGCCATTACCACTTCATTCGGCT
GGCCGGGATCGTCGGCGCGTCGGCCATCTTTATGGGCGCCTACTGCAAGT
ACGTCCTGAAGGACGTCAGCGATCCCAAGGAGCAGGTGGACTCGCAGGCC
TTTGCTGATGTGGCCAATCGCATCCACTTTCTGCACTCCTTTGCCATGAT
GGCCATGCCTCTGGCCCACTATCCCGTATTCACTGGCACTTTGATGATTA
CGGGCATGATGCTTTTCAGCGGCTGCATGTACTACCGCGCTTTGACTGGC
GAGAAGCGTCTGCAACCGTACGCGACCGTCGGAGGATTCTGCCTGATGGC
CGCGTGGCTGTCGCTGGTCCTGTAGGATGCGCGGGGCAGGCCACCTATCT
ATATTCCATGTAGCACATGCTGAACTGCAATTTAGTGCAGAGGCAAATAA
AGCTAAGCCAACTCTAACATACAACATCATCTAACATAATACAACATCAA
CTAAATATGAGTTACTATATCCGCTTTTAGCCATTATTTACAATAATTAT
AGTGAGGGCTTTGCAGCTAATGGAAGATACTTTTGAGTTAAATGCGTACA
ATCTCTTAGTGTATATAGCAGGCTAATGTAAGTCGCTAAATCGTTATAAT
GAAATAAAACAAATAAAAACGTTTTAACAAAAGAACCAAAAAAAAAAAAA
AAAAA

AT26877.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG4686-RA 1363 CG4686-RA 402..1290 1..889 4445 100 Plus
CG4686.a 798 CG4686.a 70..798 123..851 3645 100 Plus
CG42395-RA 752 CG42395-RA 306..401 329..424 360 91.6 Plus
CG42395-RA 752 CG42395-RA 442..552 465..575 240 81 Plus
CG42395-RA 752 CG42395-RA 171..285 194..308 230 80 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15690327..15690782 432..887 2280 100 Plus
chr3R 27901430 chr3R 15688902..15689210 123..431 1545 100 Plus
chrX 22417052 chrX 9467038..9467419 575..194 680 78.5 Minus
chr3R 27901430 chr3R 15688717..15688839 1..123 615 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:59:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19866414..19866871 432..889 2290 100 Plus
3R 32079331 3R 19864989..19865297 123..431 1545 100 Plus
X 23542271 X 9575323..9575704 575..194 680 78.5 Minus
3R 32079331 3R 19864804..19864926 1..123 615 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19607245..19607702 432..889 2290 100 Plus
3R 31820162 3R 19605820..19606128 123..431 1545 100 Plus
3R 31820162 3R 19605635..19605757 1..123 615 100 Plus
X 23527363 X 9583572..9583667 424..329 360 91.6 Minus
X 23527363 X 9583421..9583531 575..465 240 81 Minus
X 23527363 X 9583688..9583802 308..194 230 80 Minus
Blast to na_te.dros performed 2019-03-16 10:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1b 5171 Rt1b RT1B 5150bp 2771..2887 572..459 117 60.2 Minus
looper1 1881 looper1 LOOPER1_DM 1881bp 70..252 868..702 112 56.8 Minus

AT26877.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:10:18 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15688717..15688838 1..122 100 -> Plus
chr3R 15688902..15689210 123..431 100 -> Plus
chr3R 15690327..15690782 432..887 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:26 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
CG4686-RA 1..546 30..575 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:57:26 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
CG4686-RA 1..546 30..575 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:13:01 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
CG4686-RA 1..546 30..575 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:57:34 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
CG4686-RA 1..546 30..575 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-10 15:44:18 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
CG4686-RA 348..1164 1..817 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:57:26 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
CG4686-RA 348..1234 1..887 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:13:01 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
CG4686-RA 309..1195 1..887 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:57:34 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
CG4686-RA 309..1195 1..887 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:18 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19864804..19864925 1..122 100 -> Plus
3R 19864989..19865297 123..431 100 -> Plus
3R 19866414..19866869 432..887 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:18 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19864804..19864925 1..122 100 -> Plus
3R 19864989..19865297 123..431 100 -> Plus
3R 19866414..19866869 432..887 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:18 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19864804..19864925 1..122 100 -> Plus
3R 19864989..19865297 123..431 100 -> Plus
3R 19866414..19866869 432..887 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:13:01 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15690526..15690647 1..122 100 -> Plus
arm_3R 15690711..15691019 123..431 100 -> Plus
arm_3R 15692136..15692591 432..887 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:49:00 Download gff for AT26877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19605820..19606128 123..431 100 -> Plus
3R 19607245..19607700 432..887 100   Plus
3R 19605635..19605756 1..122 100 -> Plus

AT26877.hyp Sequence

Translation from 2 to 574

> AT26877.hyp
KQSLSKQYTMSVADTIEYVTLGNPVSKMVASSASALLRTLGLRPKKVPVQ
ETSMAVLPAAHSYAHSHGSLYRLAGCHYHFIRLAGIVGASAIFMGAYCKY
VLKDVSDPKEQVDSQAFADVANRIHFLHSFAMMAMPLAHYPVFTGTLMIT
GMMLFSGCMYYRALTGEKRLQPYATVGGFCLMAAWLSLVL*

AT26877.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG4686-PB 181 CG4686-PB 1..181 10..190 936 100 Plus
CG4686-PA 181 CG4686-PA 1..181 10..190 936 100 Plus
CG42395-PD 179 CG42395-PD 1..179 12..190 673 69.8 Plus

AT26877.pep Sequence

Translation from 2 to 574

> AT26877.pep
KQSLSKQYTMSVADTIEYVTLGNPVSKMVASSASALLRTLGLRPKKVPVQ
ETSMAVLPAAHSYAHSHGSLYRLAGCHYHFIRLAGIVGASAIFMGAYCKY
VLKDVSDPKEQVDSQAFADVANRIHFLHSFAMMAMPLAHYPVFTGTLMIT
GMMLFSGCMYYRALTGEKRLQPYATVGGFCLMAAWLSLVL*

AT26877.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:43:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17622-PA 181 GF17622-PA 1..181 10..190 771 83.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23549-PA 181 GG23549-PA 1..181 10..190 880 91.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16289-PA 176 GH16289-PA 1..176 10..190 595 65.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG4686-PB 181 CG4686-PB 1..181 10..190 936 100 Plus
CG4686-PA 181 CG4686-PA 1..181 10..190 936 100 Plus
CG42395-PD 179 CG42395-PD 1..179 12..190 673 69.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22430-PA 178 GI22430-PA 1..178 10..190 664 68.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12204-PA 179 GL12204-PA 3..179 14..190 662 69.7 Plus
Dper\GL13195-PA 183 GL13195-PA 1..183 10..190 400 45.3 Plus
Dper\GL25373-PA 155 GL25373-PA 1..152 10..160 369 47.7 Plus
Dper\GL14894-PA 181 GL14894-PA 4..180 13..189 320 40.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:43:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18356-PA 179 GA18356-PA 3..179 14..190 661 69.1 Plus
Dpse\GA22642-PA 182 GA22642-PA 1..182 10..190 479 49.7 Plus
Dpse\GA26480-PA 181 GA26480-PA 4..180 13..189 354 40.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26868-PA 180 GM26868-PA 1..180 10..190 915 96.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19318-PA 180 GD19318-PA 1..180 10..190 915 96.7 Plus
Dsim\GD16056-PA 181 GD16056-PA 1..181 10..190 690 70.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10993-PA 178 GJ10993-PA 1..178 10..190 630 68 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22810-PA 183 GK22810-PA 1..183 10..190 754 75.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25630-PA 181 GE25630-PA 1..181 10..190 895 93.4 Plus
Dyak\GE11212-PA 97 GE11212-PA 1..97 94..190 461 88.7 Plus