BDGP Sequence Production Resources |
Search the DGRC for AT26906
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 269 |
Well: | 6 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG15296-RA |
Protein status: | AT26906.pep: gold |
Preliminary Size: | 471 |
Sequenced Size: | 695 |
Gene | Date | Evidence |
---|---|---|
CG15296 | 2001-12-16 | Blastp of sequenced clone |
CG15296 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15296 | 2003-01-01 | Sim4 clustering to Release 3 |
CG15296 | 2008-04-29 | Release 5.5 accounting |
CG15296 | 2008-08-15 | Release 5.9 accounting |
CG15296 | 2008-12-18 | 5.12 accounting |
695 bp (695 high quality bases) assembled on 2001-12-16
GenBank Submission: AY070824
> AT26906.complete GTTTTCTGCGATAATGTTTACTACACTGATGTATCGAACTGCAGCGGTCT CGATGACCGTCTACATAACCAATCGAGTTGGAGTTTGGGGTAAGACAGAG GAGACGGACCACCTGCTCGATCAGATCACCAATGGTCTTCAACCAGTATT TGGACTTCTGCGACGAACGCTGAAGTTAGATGAGAGCGATCTGAGCGTGG GTGAGCTATCCCGGAAATACTACAATGAAGGAGTGAAGGGCACTTTTCGT ATCATTCGAAACATACCCAACTATTCGGAGGAATTGGCCGACGGTGCCAA GGTCACCTGTCTGGATTTGGTGGAAAAGGCCAAGGAATTGCGTCACAAAG AATATTCAAAATGGTGGAATACTTCCACAAATAAGGAGCAACTGATTATT GATTCACCAGATTCTGCAGCTGGCGATGGATCTTTCGAGGATTTAGTCCC ATTTGAGAAACCAAAGACCGTAGATAATTTTGCGGGGGAAGAGGGAAATG GAGCTCTTGAACAGAGGGTTTAAACAACTGTCTATAAACAAGAAAAATCA GCCTTACTCTCTACAAAATCTTATTGTTAAATCTTTGAGTAAAGACCATG TATCATGTTAGAATCCCCAATACTCTGCAATAGGCCAATAAATATTTTAG ATTGCCAAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15296-RA | 665 | CG15296-RA | 2..660 | 4..662 | 3295 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 10457267..10457923 | 660..4 | 3240 | 99.5 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 10565840..10566498 | 662..4 | 3295 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 10573938..10574596 | 662..4 | 3295 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 10457267..10457924 | 1..660 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15296-RA | 1..510 | 14..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15296-RA | 1..510 | 14..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15296-RA | 1..510 | 14..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15296-RA | 1..510 | 14..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15296-RA | 1..510 | 14..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15296-RA | 2..658 | 4..660 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15296-RA | 2..658 | 4..660 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15296-RB | 27..686 | 1..660 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15296-RA | 2..658 | 4..660 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15296-RB | 27..686 | 1..660 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10565842..10566499 | 1..660 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10565842..10566499 | 1..660 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10565842..10566499 | 1..660 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 10459875..10460532 | 1..660 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10573940..10574597 | 1..660 | 99 | Minus |
Translation from 4 to 522
> AT26906.hyp SAIMFTTLMYRTAAVSMTVYITNRVGVWGKTEETDHLLDQITNGLQPVFG LLRRTLKLDESDLSVGELSRKYYNEGVKGTFRIIRNIPNYSEELADGAKV TCLDLVEKAKELRHKEYSKWWNTSTNKEQLIIDSPDSAAGDGSFEDLVPF EKPKTVDNFAGEEGNGALEQRV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15296-PB | 169 | CG15296-PB | 1..169 | 4..172 | 879 | 100 | Plus |
CG15296-PA | 169 | CG15296-PA | 1..169 | 4..172 | 879 | 100 | Plus |
CG7603-PA | 122 | CG7603-PA | 1..108 | 4..107 | 159 | 36.1 | Plus |
Translation from 13 to 522
> AT26906.pep MFTTLMYRTAAVSMTVYITNRVGVWGKTEETDHLLDQITNGLQPVFGLLR RTLKLDESDLSVGELSRKYYNEGVKGTFRIIRNIPNYSEELADGAKVTCL DLVEKAKELRHKEYSKWWNTSTNKEQLIIDSPDSAAGDGSFEDLVPFEKP KTVDNFAGEEGNGALEQRV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19552-PA | 170 | GF19552-PA | 1..113 | 1..113 | 242 | 44.7 | Plus |
Dana\GF24204-PA | 121 | GF24204-PA | 1..92 | 1..88 | 156 | 35.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18914-PA | 169 | GG18914-PA | 1..168 | 1..169 | 693 | 76.9 | Plus |
Dere\GG13616-PA | 122 | GG13616-PA | 1..108 | 1..104 | 163 | 36.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15187-PA | 124 | GH15187-PA | 1..92 | 1..88 | 154 | 35.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15296-PB | 169 | CG15296-PB | 1..169 | 1..169 | 879 | 100 | Plus |
CG15296-PA | 169 | CG15296-PA | 1..169 | 1..169 | 879 | 100 | Plus |
QIL1-PA | 122 | CG7603-PA | 1..108 | 1..104 | 159 | 36.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12127-PA | 125 | GI12127-PA | 1..92 | 1..88 | 172 | 39.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15582-PA | 124 | GL15582-PA | 1..92 | 1..88 | 163 | 35.9 | Plus |
Dper\GL14881-PA | 171 | GL14881-PA | 1..77 | 1..87 | 143 | 39.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20474-PA | 124 | GA20474-PA | 1..92 | 1..88 | 160 | 34.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11305-PA | 169 | GM11305-PA | 1..169 | 1..169 | 825 | 92.3 | Plus |
Dsec\GM25700-PA | 122 | GM25700-PA | 1..108 | 1..104 | 164 | 35.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16028-PA | 169 | GD16028-PA | 1..169 | 1..169 | 827 | 92.3 | Plus |
Dsim\GD14707-PA | 122 | GD14707-PA | 1..108 | 1..104 | 165 | 35.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13399-PA | 126 | GJ13399-PA | 1..92 | 1..88 | 163 | 39.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17742-PA | 128 | GK17742-PA | 1..92 | 1..88 | 163 | 37 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19912-PA | 122 | GE19912-PA | 1..108 | 1..104 | 163 | 36.1 | Plus |