Clone AT26906 Report

Search the DGRC for AT26906

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:269
Well:6
Vector:pOTB7
Associated Gene/TranscriptCG15296-RA
Protein status:AT26906.pep: gold
Preliminary Size:471
Sequenced Size:695

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15296 2001-12-16 Blastp of sequenced clone
CG15296 2002-01-01 Sim4 clustering to Release 2
CG15296 2003-01-01 Sim4 clustering to Release 3
CG15296 2008-04-29 Release 5.5 accounting
CG15296 2008-08-15 Release 5.9 accounting
CG15296 2008-12-18 5.12 accounting

Clone Sequence Records

AT26906.complete Sequence

695 bp (695 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070824

> AT26906.complete
GTTTTCTGCGATAATGTTTACTACACTGATGTATCGAACTGCAGCGGTCT
CGATGACCGTCTACATAACCAATCGAGTTGGAGTTTGGGGTAAGACAGAG
GAGACGGACCACCTGCTCGATCAGATCACCAATGGTCTTCAACCAGTATT
TGGACTTCTGCGACGAACGCTGAAGTTAGATGAGAGCGATCTGAGCGTGG
GTGAGCTATCCCGGAAATACTACAATGAAGGAGTGAAGGGCACTTTTCGT
ATCATTCGAAACATACCCAACTATTCGGAGGAATTGGCCGACGGTGCCAA
GGTCACCTGTCTGGATTTGGTGGAAAAGGCCAAGGAATTGCGTCACAAAG
AATATTCAAAATGGTGGAATACTTCCACAAATAAGGAGCAACTGATTATT
GATTCACCAGATTCTGCAGCTGGCGATGGATCTTTCGAGGATTTAGTCCC
ATTTGAGAAACCAAAGACCGTAGATAATTTTGCGGGGGAAGAGGGAAATG
GAGCTCTTGAACAGAGGGTTTAAACAACTGTCTATAAACAAGAAAAATCA
GCCTTACTCTCTACAAAATCTTATTGTTAAATCTTTGAGTAAAGACCATG
TATCATGTTAGAATCCCCAATACTCTGCAATAGGCCAATAAATATTTTAG
ATTGCCAAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT26906.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG15296-RA 665 CG15296-RA 2..660 4..662 3295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:48:21
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10457267..10457923 660..4 3240 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:59:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10565840..10566498 662..4 3295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10573938..10574596 662..4 3295 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:48:20 has no hits.

AT26906.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:49:12 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10457267..10457924 1..660 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:24:04 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
CG15296-RA 1..510 14..523 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:01:28 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
CG15296-RA 1..510 14..523 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:34:57 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
CG15296-RA 1..510 14..523 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:26:02 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
CG15296-RA 1..510 14..523 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:41:58 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
CG15296-RA 1..510 14..523 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:27:49 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
CG15296-RA 2..658 4..660 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:01:28 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
CG15296-RA 2..658 4..660 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:34:57 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
CG15296-RB 27..686 1..660 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:26:02 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
CG15296-RA 2..658 4..660 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:41:58 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
CG15296-RB 27..686 1..660 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:12 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
X 10565842..10566499 1..660 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:12 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
X 10565842..10566499 1..660 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:49:12 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
X 10565842..10566499 1..660 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:34:57 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10459875..10460532 1..660 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:01:40 Download gff for AT26906.complete
Subject Subject Range Query Range Percent Splice Strand
X 10573940..10574597 1..660 99   Minus

AT26906.hyp Sequence

Translation from 4 to 522

> AT26906.hyp
SAIMFTTLMYRTAAVSMTVYITNRVGVWGKTEETDHLLDQITNGLQPVFG
LLRRTLKLDESDLSVGELSRKYYNEGVKGTFRIIRNIPNYSEELADGAKV
TCLDLVEKAKELRHKEYSKWWNTSTNKEQLIIDSPDSAAGDGSFEDLVPF
EKPKTVDNFAGEEGNGALEQRV*

AT26906.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG15296-PB 169 CG15296-PB 1..169 4..172 879 100 Plus
CG15296-PA 169 CG15296-PA 1..169 4..172 879 100 Plus
CG7603-PA 122 CG7603-PA 1..108 4..107 159 36.1 Plus

AT26906.pep Sequence

Translation from 13 to 522

> AT26906.pep
MFTTLMYRTAAVSMTVYITNRVGVWGKTEETDHLLDQITNGLQPVFGLLR
RTLKLDESDLSVGELSRKYYNEGVKGTFRIIRNIPNYSEELADGAKVTCL
DLVEKAKELRHKEYSKWWNTSTNKEQLIIDSPDSAAGDGSFEDLVPFEKP
KTVDNFAGEEGNGALEQRV*

AT26906.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19552-PA 170 GF19552-PA 1..113 1..113 242 44.7 Plus
Dana\GF24204-PA 121 GF24204-PA 1..92 1..88 156 35.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18914-PA 169 GG18914-PA 1..168 1..169 693 76.9 Plus
Dere\GG13616-PA 122 GG13616-PA 1..108 1..104 163 36.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15187-PA 124 GH15187-PA 1..92 1..88 154 35.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG15296-PB 169 CG15296-PB 1..169 1..169 879 100 Plus
CG15296-PA 169 CG15296-PA 1..169 1..169 879 100 Plus
QIL1-PA 122 CG7603-PA 1..108 1..104 159 36.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12127-PA 125 GI12127-PA 1..92 1..88 172 39.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15582-PA 124 GL15582-PA 1..92 1..88 163 35.9 Plus
Dper\GL14881-PA 171 GL14881-PA 1..77 1..87 143 39.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20474-PA 124 GA20474-PA 1..92 1..88 160 34.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11305-PA 169 GM11305-PA 1..169 1..169 825 92.3 Plus
Dsec\GM25700-PA 122 GM25700-PA 1..108 1..104 164 35.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16028-PA 169 GD16028-PA 1..169 1..169 827 92.3 Plus
Dsim\GD14707-PA 122 GD14707-PA 1..108 1..104 165 35.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13399-PA 126 GJ13399-PA 1..92 1..88 163 39.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17742-PA 128 GK17742-PA 1..92 1..88 163 37 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19912-PA 122 GE19912-PA 1..108 1..104 163 36.1 Plus